PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID KHN12198.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Glycine; Soja
Family Dof
Protein Properties Length: 489aa    MW: 53470.5 Da    PI: 7.1832
Description Dof family protein
Gene Model
Gene Model ID Type Source Coding Sequence
KHN12198.1genomeTCUHKView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1zf-Dof125.22e-39149208261
      zf-Dof   2 kekalkcprCdstntkfCyynnyslsqPryfCkaCrryWtkGGalrnvPvGggrrknkks 61 
                 ++k l+cprC+s++tkfCyynny+++qPr+fCk+C+ryWt+GG++rnvPvG+grrknk++
  KHN12198.1 149 PDKVLPCPRCNSMDTKFCYYNNYNVNQPRHFCKNCQRYWTAGGTMRNVPVGAGRRKNKNT 208
                 78999*****************************************************87 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
ProDomPD0074782.0E-31146206IPR003851Zinc finger, Dof-type
PfamPF027014.4E-32150207IPR003851Zinc finger, Dof-type
PROSITE profilePS5088428.975153207IPR003851Zinc finger, Dof-type
PROSITE patternPS013610155191IPR003851Zinc finger, Dof-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 489 aa     Download sequence    Send to blast
MSEVVTKDSA IKLFGRTISL SRNNNNNNNN NNNNEVSSSA NGFSSDEPAP PEDSSSSFPR  60
EVSSTTEHEA GRDKEPSRKE LTSAQEEDEE ASHQTIEEPK SPTSSSCNLE NPKTPSTERE  120
TSILKSSKTG DQSDATTTSP SQDKTLKKPD KVLPCPRCNS MDTKFCYYNN YNVNQPRHFC  180
KNCQRYWTAG GTMRNVPVGA GRRKNKNTPS SLSHFRQIMV PEGLQNGSLH GAAVLTFGSD  240
PPLCDSMASV LSLAEKTTQN GFHSPNGDEY YDTVMASTLS ERRDNATTST NSRQESLDNH  300
KSYHHHHHHH HHQGFTPQLC FPGSSSSPWP YPSNNPIMTP SAFCHPVPFY PTQAFWGSMP  360
PPSWSVNYQS APGSGPNSPT LGKHSRDGDI LFSTDMAANN NNNNTVLIPK TLRIDDPTEA  420
AKSSIWSTLG IKNEKGNSLN GGGLFKAFAS KGNSDDKKNH AVMVEASPSP VLQANPAALS  480
RSLVFHERT
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_003520081.10.0PREDICTED: cyclic dof factor 1-like
TrEMBLA0A0B2PWS80.0A0A0B2PWS8_GLYSO; Dof zinc finger protein DOF5.2
STRINGGLYMA02G12081.10.0(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF62534147
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G47500.12e-75cycling DOF factor 3
Publications ? help Back to Top
  1. Qi X, et al.
    Identification of a novel salt tolerance gene in wild soybean by whole-genome sequencing.
    Nat Commun, 2014. 5: p. 4340
    [PMID:25004933]