PlantTFDB
Plant Transcription Factor Database
v5.0
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID KHN11898.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Glycine; Soja
Family LBD
Protein Properties Length: 96aa    MW: 10899.3 Da    PI: 4.579
Description LBD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
KHN11898.1genomeTCUHKView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF26047.74.5e-1515745101
      DUF260  45 llkalpeeeredamsslvyeAearardPvyGavgvilklqqqleqlkaelallkeel 101
                 +l+++p   re+a++sl++eA++r++dPvyG++g+i+kl +q+++++  la++++++
  KHN11898.1   1 MLQQIPSYLREQAANSLYFEAQCRIQDPVYGCAGIISKLYEQINSTEIALAHVQTQI 57 
                 78999999******************************************9999875 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5089110.628157IPR004883Lateral organ boundaries, LOB
PfamPF031952.6E-13154IPR004883Lateral organ boundaries, LOB
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0004088Molecular Functioncarbamoyl-phosphate synthase (glutamine-hydrolyzing) activity
Sequence ? help Back to Top
Protein Sequence    Length: 96 aa     Download sequence    Send to blast
MLQQIPSYLR EQAANSLYFE AQCRIQDPVY GCAGIISKLY EQINSTEIAL AHVQTQIACQ  60
KLQVPQAKAE SNFNVFPAQN SSTAEFQWES QVPWFN
Cis-element ? help Back to Top
SourceLink
PlantRegMapKHN11898.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006595718.12e-64LOB domain-containing protein 24
RefseqXP_028201029.12e-64LOB domain-containing protein 24-like
SwissprotP594677e-15LBD23_ARATH; LOB domain-containing protein 23
SwissprotP594686e-15LBD24_ARATH; LOB domain-containing protein 24
TrEMBLA0A445H0F84e-63A0A445H0F8_GLYSO; LOB domain-containing protein 24
TrEMBLK7M4H24e-63K7M4H2_SOYBN; Uncharacterized protein
STRINGGLYMA14G02440.26e-64(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF36973066
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G26660.13e-17LOB domain-containing protein 24
Publications ? help Back to Top
  1. Qi X, et al.
    Identification of a novel salt tolerance gene in wild soybean by whole-genome sequencing.
    Nat Commun, 2014. 5: p. 4340
    [PMID:25004933]