PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID KHN11452.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Glycine; Soja
Family MYB_related
Protein Properties Length: 236aa    MW: 26729.8 Da    PI: 6.8095
Description MYB_related family protein
Gene Model
Gene Model ID Type Source Coding Sequence
KHN11452.1genomeTCUHKView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding445.1e-14122166347
                      SS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
  Myb_DNA-binding   3 rWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                      +WT+eE+ l++ +  ++G+g+W++I+r +  +Rt+ q+ s+ qky
       KHN11452.1 122 PWTEEEHRLFLIGLSKFGKGDWRSISRNVVVTRTPTQVASHAQKY 166
                      8*******************************************9 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM007170.00121365IPR001005SANT/Myb domain
SuperFamilySSF466891.54E-101571IPR009057Homeodomain-like
PROSITE profilePS500906.2261763IPR017877Myb-like domain
CDDcd001675.56E-51763No hitNo description
Gene3DG3DSA:1.10.10.604.4E-43763IPR009057Homeodomain-like
PROSITE profilePS5129420.947115171IPR017930Myb domain
SuperFamilySSF466894.28E-17117172IPR009057Homeodomain-like
TIGRFAMsTIGR015572.9E-17118170IPR006447Myb domain, plants
SMARTSM007177.3E-11119169IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.603.2E-11119165IPR009057Homeodomain-like
PfamPF002496.4E-12122166IPR001005SANT/Myb domain
CDDcd001671.53E-9122167No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 236 aa     Download sequence    Send to blast
MFQESSATRW PTQPTQWTRY HDKLFERALL VVPEDLPDRW EKIADQVPGK SAVEVREHYE  60
ALVHDVFEID SGRVEVPSYV DDSVAMPLSG GAGISTWDNA NQISFGSKLK QQGENERKKG  120
TPWTEEEHRL FLIGLSKFGK GDWRSISRNV VVTRTPTQVA SHAQKYFLRQ NSVKKERKRS  180
SIHDITTVDS NSVPVPIDQN WVPPPGGSVQ QSLQYPSSNM LDQMGTFGYS NYGFGM
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
2cjj_A1e-13679273RADIALIS
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtTranscription activator that coordinates abscisic acid (ABA) biosynthesis and signaling-related genes via binding to the specific promoter motif 5'-(A/T)AACCAT-3'. Represses ABA-mediated salt (e.g. NaCl and KCl) stress tolerance. Regulates leaf shape and promotes vegetative growth. {ECO:0000269|PubMed:26243618}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapKHN11452.1
Regulation -- Description ? help Back to Top
Source Description
UniProtINDUCTION: Induced by salicylic acid (SA) and gibberellic acid (GA) (PubMed:16463103). Triggered by dehydration and salt stress (PubMed:26243618). {ECO:0000269|PubMed:16463103, ECO:0000269|PubMed:26243618}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAB0830280.0AB083028.1 Glycine max mRNA for syringolide-induced protein 1-3-1B, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqNP_001237103.11e-171syringolide-induced protein 1-3-1B
RefseqXP_028219573.11e-171transcription factor SRM1-like
SwissprotQ9FNN61e-59SRM1_ARATH; Transcription factor SRM1
TrEMBLA0A445F3L11e-170A0A445F3L1_GLYSO; Transcription factor SRM1
TrEMBLQ8S8Z91e-170Q8S8Z9_SOYBN; Syringolide-induced protein 1-3-1B
STRINGGLYMA20G24600.11e-170(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF60683251
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G04760.15e-84MYB family protein
Publications ? help Back to Top
  1. Qi X, et al.
    Identification of a novel salt tolerance gene in wild soybean by whole-genome sequencing.
    Nat Commun, 2014. 5: p. 4340
    [PMID:25004933]
  2. Wang T, et al.
    Salt-Related MYB1 Coordinates Abscisic Acid Biosynthesis and Signaling during Salt Stress in Arabidopsis.
    Plant Physiol., 2015. 169(2): p. 1027-41
    [PMID:26243618]
  3. Chen YS, et al.
    Two MYB-related transcription factors play opposite roles in sugar signaling in Arabidopsis.
    Plant Mol. Biol., 2017. 93(3): p. 299-311
    [PMID:27866313]