PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID KHN11366.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Glycine; Soja
Family MYB_related
Protein Properties Length: 749aa    MW: 81992.1 Da    PI: 5.8666
Description MYB_related family protein
Gene Model
Gene Model ID Type Source Coding Sequence
KHN11366.1genomeTCUHKView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding50.64.3e-162468147
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47
                     r rWT+eE+ ++++a k++G   W +I +++g ++t+ q++s+ qk+
       KHN11366.1 24 RERWTEEEHNRFLEALKLYGRA-WQRIEEHIG-TKTAVQIRSHAQKF 68
                     78******************88.*********.************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF466898.22E-171874IPR009057Homeodomain-like
PROSITE profilePS5129420.1731973IPR017930Myb domain
Gene3DG3DSA:1.10.10.602.2E-82171IPR009057Homeodomain-like
TIGRFAMsTIGR015576.9E-172271IPR006447Myb domain, plants
SMARTSM007171.1E-122371IPR001005SANT/Myb domain
PfamPF002493.1E-132467IPR001005SANT/Myb domain
CDDcd001671.44E-92669No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009409Biological Processresponse to cold
GO:0009651Biological Processresponse to salt stress
GO:0009723Biological Processresponse to ethylene
GO:0009733Biological Processresponse to auxin
GO:0009737Biological Processresponse to abscisic acid
GO:0009739Biological Processresponse to gibberellin
GO:0009751Biological Processresponse to salicylic acid
GO:0009753Biological Processresponse to jasmonic acid
GO:0042754Biological Processnegative regulation of circadian rhythm
GO:0043433Biological Processnegative regulation of sequence-specific DNA binding transcription factor activity
GO:0046686Biological Processresponse to cadmium ion
GO:0048574Biological Processlong-day photoperiodism, flowering
GO:0005634Cellular Componentnucleus
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0044212Molecular Functiontranscription regulatory region DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 749 aa     Download sequence    Send to blast
MDADSSGEEV LIKTRKPYTI TKQRERWTEE EHNRFLEALK LYGRAWQRIE EHIGTKTAVQ  60
IRSHAQKFFT KLEKEAFVKG VPIGQALDID IPPPRPKRKP NNPYPRKTNV GGAPTLHSGA  120
RHGKPLISIV SSLGKQALGL EKEPLPEKHD VDLRPSTVKE NKDQSCSKVF TILQEAPCSS  180
VSSANKNSTS ILVPLRNSCA LRKFIPSVKD VITQDETNDS FVTDDLENQK LEIDDGKHTQ  240
KSNGTCKVSK SENSGASELV QTEKTDGLNC ALTIEGVQGN QNYPRHVPVH VVDGNLGTST  300
QNPSPDMVFQ DSIFQPKGGV NGQPNLVTIS ATSNISESQN NTARSSIHQS FPPCPTFTQD  360
DYHSFLQVSS TFSSLIVSTL LQNPAAHAAA SFAATFWPYA NAETSADSPM CTPDFPSRQI  420
GSPPSVTAIA AATVAAATAW WAAHGLLPLC APLHTAFACP PASAIAVPLM NIDESPQKTE  480
QEEIKPQNSS LQDQILDPEH SEAQHSAPKS PAVFSSKSEE RGDANLNTSP KATNHETNQV  540
ISENPDSNKM KGRKPVDRSS CGSNTTSSSE ETELLLKDEK EKEEPKTPDA NILDTELSNR  600
RSRSINNLTD SWKEVSEEGR LAFQALFSRE VLPQSFSPTH DLINEDNQID SIKDNDQNTD  660
YKDEDLESKK CSSNSDGVQK NLLFVKDNNE EEGLLIIGLG PGKLKTRPTG FKPYKRCSVE  720
ANENRIGTAC NQGEEKGPKR IRLNGEAST
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00119DAPTransfer from AT1G01060Download
Motif logo
Cis-element ? help Back to Top
SourceLink
PlantRegMapKHN11366.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankEU0764340.0EU076434.1 Glycine max late elongated hypocotyl and circadian clock associated-1-like protein 2 (LCL2) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_028216411.10.0protein LHY-like isoform X3
RefseqXP_028216412.10.0protein LHY-like isoform X3
TrEMBLA0A0B2PPQ50.0A0A0B2PPQ5_GLYSO; Protein LHY
STRINGGLYMA19G45030.20.0(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF48602537
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G46830.11e-79circadian clock associated 1
Publications ? help Back to Top
  1. Qi X, et al.
    Identification of a novel salt tolerance gene in wild soybean by whole-genome sequencing.
    Nat Commun, 2014. 5: p. 4340
    [PMID:25004933]