PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID KHN11281.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Glycine; Soja
Family LBD
Protein Properties Length: 306aa    MW: 34325 Da    PI: 4.8757
Description LBD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
KHN11281.1genomeTCUHKView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF2601284.4e-40251241100
      DUF260   1 aCaaCkvlrrkCakdCvlapyfpaeqpkkfanvhklFGasnvlkllkalpeeeredamsslvyeAearardPvyGavgvilklqqqleqlkaelallke 99 
                 aCaaCk++rrkCa+dC+lapyfp+e++++f n+hklFG+sn++k++k l+++++++am++++y++++ra dPv G+++ il+lq q+e  +ael+l+ +
  KHN11281.1  25 ACAACKYQRRKCAPDCILAPYFPHERQRQFLNAHKLFGVSNITKIIKLLSPQDKDQAMRTIIYQSDMRATDPVGGCYRYILDLQAQIEYYRAELELVLQ 123
                 7*********************************************************************************************99877 PP

      DUF260 100 e 100
                 +
  KHN11281.1 124 Q 124
                 6 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5089124.97224125IPR004883Lateral organ boundaries, LOB
PfamPF031952.4E-3725121IPR004883Lateral organ boundaries, LOB
Sequence ? help Back to Top
Protein Sequence    Length: 306 aa     Download sequence    Send to blast
MNNNNPNNNS NRISSPRNGN STTQACAACK YQRRKCAPDC ILAPYFPHER QRQFLNAHKL  60
FGVSNITKII KLLSPQDKDQ AMRTIIYQSD MRATDPVGGC YRYILDLQAQ IEYYRAELEL  120
VLQQLAIFRA QAQQQQQQQH GIYAPNNVNI AVNGDGEVLN ADPMGLYDQQ QHYQCLQPQQ  180
QEQYAMMHEN GHGSQNSDGT AFQEQINTWA VQNTAVSLSS LSLQGQGSNV SDGYDHKPVL  240
GIDMDSDERS ELGFESEELV HRSDEAVLFK IDDAVIKAEA DQCMQQAQDH DLKGAATSFT  300
LTNCTC
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5ly0_A9e-262612512111LOB family transfactor Ramosa2.1
5ly0_B9e-262612512111LOB family transfactor Ramosa2.1
Search in ModeBase
Cis-element ? help Back to Top
SourceLink
PlantRegMapKHN11281.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_028244866.10.0LOB domain-containing protein 22-like
TrEMBLA0A445JH370.0A0A445JH37_GLYSO; LOB domain-containing protein 22
STRINGGLYMA08G20550.20.0(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF41333259
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G13850.13e-51LOB domain-containing protein 22
Publications ? help Back to Top
  1. Qi X, et al.
    Identification of a novel salt tolerance gene in wild soybean by whole-genome sequencing.
    Nat Commun, 2014. 5: p. 4340
    [PMID:25004933]