PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID KHN11159.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Glycine; Soja
Family MYB_related
Protein Properties Length: 333aa    MW: 38634 Da    PI: 6.2865
Description MYB_related family protein
Gene Model
Gene Model ID Type Source Coding Sequence
KHN11159.1genomeTCUHKView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding249.2e-08181224447
                      S-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
  Myb_DNA-binding   4 WTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                      WT eE+  ++ + +  G+++W+ I++++   + + q+ s+ qky
       KHN11159.1 181 WTREEHISFLLGLENVGKKSWTYISQKFVPSKNPFQVASHAQKY 224
                      *****************************9*************9 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS500906.017173225IPR017877Myb-like domain
SuperFamilySSF466891.48E-12174228IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.604.1E-6176228IPR009057Homeodomain-like
TIGRFAMsTIGR015571.3E-10176228IPR006447Myb domain, plants
SMARTSM007170.005177227IPR001005SANT/Myb domain
CDDcd001670.0019181225No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 333 aa     Download sequence    Send to blast
MSHEENKNVI EFLDEQAFYY DEEDEQWFKE KDDQWTKNIP CYKEDAANVV LNSVDFDFDM  60
QDLDEFLKDL GTEDSSPERV PDPVVPISGG VQVPSPPRVH APAPQRVYTF ADLVSATSAP  120
TARVPTPHES PEETFNGIAS GQVHAPISHQ HHLLPQNMES NRVMLAGDSS RSVPCKKYTH  180
WTREEHISFL LGLENVGKKS WTYISQKFVP SKNPFQVASH AQKYFKRKNT PKKERKRKSI  240
HDITLDDINT IVNPRIDQHN WIPPPPNFAT QPNEIQQAQP MQQFNLHNPF HQMQQFNLHN  300
PFHQMQQFQH NMSSQMDKYG YFNNWLHAIE HGN
Cis-element ? help Back to Top
SourceLink
PlantRegMapKHN11159.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
TrEMBLA0A0B2PU060.0A0A0B2PU06_GLYSO; Transcription factor MYB1R1
STRINGGLYMA10G30320.11e-157(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF13860414
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G04760.12e-21MYB family protein
Publications ? help Back to Top
  1. Qi X, et al.
    Identification of a novel salt tolerance gene in wild soybean by whole-genome sequencing.
    Nat Commun, 2014. 5: p. 4340
    [PMID:25004933]