PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID KHN11044.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Glycine; Soja
Family ARF
Protein Properties Length: 669aa    MW: 74700 Da    PI: 5.9275
Description ARF family protein
Gene Model
Gene Model ID Type Source Coding Sequence
KHN11044.1genomeTCUHKView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1B368.59.5e-22118222198
                 EEEE-..-HHHHTT-EE--HHH.HTT.......---..--SEEEEEETTS-EEEEEE..EEETTEEEE-TTHHHHHHHHT--TT-EEEEE..E-SSSEE CS
          B3   1 ffkvltpsdvlksgrlvlpkkfaeeh.......ggkkeesktltledesgrsWevkliyrkksgryvltkGWkeFvkangLkegDfvvFk..ldgrsef 90 
                 f+k+lt sd++++g +++ +++a+++       ++++ +  +l+ +d++g++W +++i+r++++r++lt+GW+ Fv++++L +gD ++F   +++ +++
  KHN11044.1 118 FCKTLTASDTSTHGGFSVLRRHADDClppldmtQQPPWQ--ELVATDLHGNEWHFRHIFRGQPRRHLLTTGWSVFVSSKKLVAGDAFIFLrqVVQGENG 214
                 99****************************975444444..8***********************************************944445699* PP

                 ..EEEEE- CS
          B3  91 elvvkvfr 98 
                 el+v+v+r
  KHN11044.1 215 ELRVGVRR 222
                 *****997 PP

2Auxin_resp111.58.4e-37248330183
  Auxin_resp   1 aahaastksvFevvYnPrastseFvvkvekvekalkvkvsvGmRfkmafetedsserrlsGtvvgvsdldpvrWpnSkWrsLk 83 
                 a+ha++t++ F+v+Y+Pr+s+seF+v+v+k+++a ++k+svGmRfkm+fe+++++err+sGt+vgv d +++ W +S+WrsLk
  KHN11044.1 248 ASHAIATGTLFSVFYKPRTSRSEFIVSVNKYLEAQSHKLSVGMRFKMRFEGDEVPERRFSGTIVGVGDNKSSVWADSEWRSLK 330
                 789******************************************************************************96 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019362.75E-41109251IPR015300DNA-binding pseudobarrel domain
Gene3DG3DSA:2.40.330.107.0E-39110237IPR015300DNA-binding pseudobarrel domain
CDDcd100178.05E-20116222No hitNo description
SMARTSM010191.0E-18118224IPR003340B3 DNA binding domain
PfamPF023621.0E-19118222IPR003340B3 DNA binding domain
PROSITE profilePS5086310.912118224IPR003340B3 DNA binding domain
PfamPF065075.6E-35248330IPR010525Auxin response factor
PfamPF023098.4E-12542635IPR033389AUX/IAA domain
PROSITE profilePS5174526.393545637IPR000270PB1 domain
SuperFamilySSF542773.53E-11547622No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009734Biological Processauxin-activated signaling pathway
GO:0010150Biological Processleaf senescence
GO:0045892Biological Processnegative regulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0042802Molecular Functionidentical protein binding
Sequence ? help Back to Top
Protein Sequence    Length: 669 aa     Download sequence    Send to blast
MASAAPGATN DALYKELWHA CAGPLVTLPR EGERVYYFPQ GHMEQLEASM NQGLEQQMPS  60
FNLPSKILCK VVNVHLRAEP ETDEVYAQIT LLPEADQSEV TSPDDPLPES PRCTVHSFCK  120
TLTASDTSTH GGFSVLRRHA DDCLPPLDMT QQPPWQELVA TDLHGNEWHF RHIFRGQPRR  180
HLLTTGWSVF VSSKKLVAGD AFIFLRQVVQ GENGELRVGV RRLMRQQSNM PSSVISSHSM  240
HLGVLATASH AIATGTLFSV FYKPRTSRSE FIVSVNKYLE AQSHKLSVGM RFKMRFEGDE  300
VPERRFSGTI VGVGDNKSSV WADSEWRSLK VQWDEPSSIL RPDRVSPWEL EPLVSTPPTN  360
PQPSQRNKRS RPPILPSTMP DSSLQGVWKS PVESAPFSYC DHQHGRDVYP STNFNSTATG  420
FLGFGGNCYA SNKSIYWSSR MENSTESFSP VALKEFGEKR QGTANGCRLF RIQLHDNSNS  480
NEESLPMVTL SGRMGDDGPL PSLDAESDQH SEPSNVNRSD IPSVSCDAEK SCLRSPQESQ  540
SRQIRSCTKV HMQGMAVGRA VDLTRFDGYE DLLRKLEEMF DITGELCGST KKWQVVYTDN  600
EDDMMMVGDD PWLEFCSIVR KIFIYTAEEV RKLSPKIGLP ISEEVKPSKM DSEAVANPED  660
QSSIVGPGC
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4ldv_A0.0735513357Auxin response factor 1
4ldw_A0.0735513357Auxin response factor 1
4ldw_B0.0735513357Auxin response factor 1
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtAuxin response factors (ARFs) are transcriptional factors that bind specifically to the DNA sequence 5'-TGTCTC-3' found in the auxin-responsive promoter elements (AuxREs). Seems to act as transcriptional repressor. Formation of heterodimers with Aux/IAA proteins may alter their ability to modulate early auxin response genes expression. Promotes flowering, stamen development, floral organ abscission and fruit dehiscence. Acts as repressor of IAA2, IAA3 and IAA7. {ECO:0000269|PubMed:12036261, ECO:0000269|PubMed:16176952}.
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00097PBMTransfer from AT1G59750Download
Motif logo
Cis-element ? help Back to Top
SourceLink
PlantRegMapKHN11044.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_003540131.10.0auxin response factor 1
SwissprotQ8L7G00.0ARFA_ARATH; Auxin response factor 1
TrEMBLA0A0B2PTQ70.0A0A0B2PTQ7_GLYSO; Auxin response factor
STRINGGLYMA12G28550.10.0(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF68022638
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G59750.40.0auxin response factor 1
Publications ? help Back to Top
  1. Qi X, et al.
    Identification of a novel salt tolerance gene in wild soybean by whole-genome sequencing.
    Nat Commun, 2014. 5: p. 4340
    [PMID:25004933]
  2. Montesinos JC,Pastor-Cantizano N,Robinson DG,Marcote MJ,Aniento F
    Arabidopsis p24δ5 and p24δ9 facilitate Coat Protein I-dependent transport of the K/HDEL receptor ERD2 from the Golgi to the endoplasmic reticulum.
    Plant J., 2014. 80(6): p. 1014-30
    [PMID:25312353]
  3. Marais C, et al.
    The Qb-SNARE Memb11 interacts specifically with Arf1 in the Golgi apparatus of Arabidopsis thaliana.
    J. Exp. Bot., 2015. 66(21): p. 6665-78
    [PMID:26208648]
  4. Wójcikowska B,Gaj MD
    Expression profiling of AUXIN RESPONSE FACTOR genes during somatic embryogenesis induction in Arabidopsis.
    Plant Cell Rep., 2017. 36(6): p. 843-858
    [PMID:28255787]
  5. Zhang M,Hu X,Zhu M,Xu M,Wang L
    Transcription factors NF-YA2 and NF-YA10 regulate leaf growth via auxin signaling in Arabidopsis.
    Sci Rep, 2017. 7(1): p. 1395
    [PMID:28469131]