PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID KHN10892.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Glycine; Soja
Family SBP
Protein Properties Length: 187aa    MW: 21705.2 Da    PI: 8.0512
Description SBP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
KHN10892.1genomeTCUHKView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SBP126.31.2e-39480177
                --SSTT-----TT--HHHHHTT--HHHHT-S-EEETTEEEEE-TTTSSEEETTT--SS--S-STTTT-------S-- CS
         SBP  1 lCqvegCeadlseakeyhrrhkvCevhskapvvlvsgleqrfCqqCsrfhelsefDeekrsCrrrLakhnerrrkkq 77
                +CqvegC++ l +akeyhrrh+vC++hskap+++v gleqrfCqqCsrfh +sefD++krsCrrrLa+hnerrrk++
  KHN10892.1  4 RCQVEGCHVALVNAKEYHRRHRVCDKHSKAPKAVVLGLEQRFCQQCSRFHVVSEFDDSKRSCRRRLAGHNERRRKSS 80
                6**************************************************************************86 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:4.10.1100.101.4E-32266IPR004333Transcription factor, SBP-box
PROSITE profilePS5114131.906279IPR004333Transcription factor, SBP-box
SuperFamilySSF1036122.45E-37381IPR004333Transcription factor, SBP-box
PfamPF031105.5E-31578IPR004333Transcription factor, SBP-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 187 aa     Download sequence    Send to blast
MVPRCQVEGC HVALVNAKEY HRRHRVCDKH SKAPKAVVLG LEQRFCQQCS RFHVVSEFDD  60
SKRSCRRRLA GHNERRRKSS HLSVTRNSRQ GCALSLLSSG SSSENWLSHH ADFSTRCSAA  120
LRELIAENRA ALITRQQQLV YDRDWPHVVP HHDAAVEEEE EDFEDLQQQQ QPPEPNYFPQ  180
QHMFPQT
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1ul4_A2e-285781184squamosa promoter binding protein-like 4
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtTrans-acting factor that binds specifically to the consensus nucleotide sequence 5'-TNCGTACAA-3' (By similarity). May be involved in panicle development. {ECO:0000250}.
UniProtTrans-acting factor that binds specifically to the consensus nucleotide sequence 5'-TNCGTACAA-3' (By similarity). May be involved in panicle development. {ECO:0000250}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapKHN10892.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqNP_001340412.11e-138LRR receptor kinase-like protein
RefseqXP_028225093.11e-138squamosa promoter-binding-like protein 7
SwissprotQ01JD12e-50SPL7_ORYSI; Squamosa promoter-binding-like protein 7
SwissprotQ7XT422e-50SPL7_ORYSJ; Squamosa promoter-binding-like protein 7
TrEMBLA0A445LBI81e-136A0A445LBI8_GLYSO; Squamosa promoter-binding-like protein 7 isoform A
TrEMBLK7KEH71e-136K7KEH7_SOYBN; Uncharacterized protein
STRINGGLYMA03G27195.11e-137(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF96132738
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G42200.18e-37squamosa promoter binding protein-like 9
Publications ? help Back to Top
  1. Kikuchi S, et al.
    Collection, mapping, and annotation of over 28,000 cDNA clones from japonica rice.
    Science, 2003. 301(5631): p. 376-9
    [PMID:12869764]