PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID KHN10772.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Glycine; Soja
Family G2-like
Protein Properties Length: 465aa    MW: 51477.9 Da    PI: 5.0789
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
KHN10772.1genomeTCUHKView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like109.61.6e-34239293155
     G2-like   1 kprlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRl 55 
                 kpr+rWtpeLHe+Fveav+qLGGse+AtPk +l+lmkv+gLt++hvkSHLQkYR+
  KHN10772.1 239 KPRMRWTPELHEAFVEAVNQLGGSERATPKGVLKLMKVEGLTIYHVKSHLQKYRT 293
                 79****************************************************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129413.061236296IPR017930Myb domain
SuperFamilySSF466893.76E-18237293IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.603.7E-32238295IPR009057Homeodomain-like
TIGRFAMsTIGR015576.3E-25239293IPR006447Myb domain, plants
PfamPF002494.3E-10241292IPR001005SANT/Myb domain
PfamPF143796.5E-26324370IPR025756MYB-CC type transcription factor, LHEQLE-containing domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 465 aa     Download sequence    Send to blast
MGMSEVFPSS LPVLPSPLEE TFPKLSDSRP AFMEKELKTK PFTHSSHLTS SGAVGHMFSS  60
SPGYSTDLHH SSFSSYEKQP RNTHFISQPL GNMASLPLSY SSNSEPIPST TSTPYSNGNS  120
VSWHTDSLPS FLDFTANTSV DNSQVENRAC NIMATEEYSK RNDWQEWADQ LISDVDPLTS  180
NWNDLLADNI QDLEPKVTKS SSQLPIEHQS QSHQQLCASS GENRVGVAPT SSTNSAPAKP  240
RMRWTPELHE AFVEAVNQLG GSERATPKGV LKLMKVEGLT IYHVKSHLQK YRTARYRPES  300
SEGAAEKNLS RIEEMSSLDL KTGIEITEAL RLQMEVQKRL HEQLEIQRNL QLRIEEQGRY  360
LQMMFEKQCK PGIETFKASS SVIESQSGVS SDAIKDSPAK TESETIKVDH CKSGADLANG  420
STTVEESSLE VAEKQDAPEI QASDNPEQHA SEDSGNASKR PRTEE
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAC2352890.0AC235289.1 Glycine max strain Williams 82 clone GM_WBb0056M24, complete sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006576956.10.0PREDICTED: protein PHR1-LIKE 1-like
RefseqXP_014629322.10.0PREDICTED: protein PHR1-LIKE 1-like
RefseqXP_006576955.10.0PREDICTED: protein PHR1-LIKE 1-like
TrEMBLA0A0B2PTC80.0A0A0B2PTC8_GLYSO; Myb family transcription factor APL
STRINGGLYMA03G32350.10.0(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF15123498
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G28610.11e-104phosphate starvation response 1
Publications ? help Back to Top
  1. Qi X, et al.
    Identification of a novel salt tolerance gene in wild soybean by whole-genome sequencing.
    Nat Commun, 2014. 5: p. 4340
    [PMID:25004933]