PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID KHN10051.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Glycine; Soja
Family MYB_related
Protein Properties Length: 129aa    MW: 14759 Da    PI: 9.9179
Description MYB_related family protein
Gene Model
Gene Model ID Type Source Coding Sequence
KHN10051.1genomeTCUHKView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding223.9e-072465346
                     SS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
  Myb_DNA-binding  3 rWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46
                      WT eE + + + ++ +G+  +++Ia+ +  ++t  +c+++++k
       KHN10051.1 24 CWTSEERKTFTEKFAAFGKY-FRRIASFID-HKTTVDCVEFYYK 65
                     6*****************99.*********.***********97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF466891.05E-12868IPR009057Homeodomain-like
PROSITE profilePS512939.2772071IPR017884SANT domain
Gene3DG3DSA:1.10.10.605.5E-52577IPR009057Homeodomain-like
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 129 aa     Download sequence    Send to blast
MFNSSNELVE DPLAVERERA MINCWTSEER KTFTEKFAAF GKYFRRIASF IDHKTTVDCV  60
EFYYKDHKPN CLEKDKNKKN KKKGCKSQKS KTSKTIVKGL GKKGNCKANV DSQKKLIEAP  120
AMACDTAAY
Cis-element ? help Back to Top
SourceLink
PlantRegMapKHN10051.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_028197190.11e-45nuclear receptor corepressor 1-like
TrEMBLA0A0B2PKX42e-90A0A0B2PKX4_GLYSO; Nuclear receptor corepressor 2
STRINGAES622021e-35(Medicago truncatula)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G52250.11e-22MYB family protein
Publications ? help Back to Top
  1. Qi X, et al.
    Identification of a novel salt tolerance gene in wild soybean by whole-genome sequencing.
    Nat Commun, 2014. 5: p. 4340
    [PMID:25004933]