PlantTFDB
Plant Transcription Factor Database
PlantRegMap/PlantTFDB v5.0
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID KHN09737.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Glycine; Soja
Family TALE
Protein Properties Length: 512aa    MW: 57841.7 Da    PI: 6.6137
Description TALE family protein
Gene Model
Gene Model ID Type Source Coding Sequence
KHN09737.1genomeTCUHKView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox22.12.5e-071441772154
                 HSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHH CS
    Homeobox  21 knrypsaeereeLAkklgLterqVkvWFqNrRak 54 
                 k +yp+++++++L +++gL+ +q+ +WF N+R +
  KHN09737.1 144 KWPYPTEDDKAKLVEETGLQLKQINNWFINQRKR 177
                 469*****************************87 PP

2ELK24.66e-0998119122
         ELK   1 ELKhqLlrKYsgyLgsLkqEFs 22 
                 ELK +L++++++++ ++++E++
  KHN09737.1  98 ELKIELKQGFKSRIEDVREEIL 119
                 9*******************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF037914.9E-11141IPR005541KNOX2
SMARTSM012563.3E-11142IPR005541KNOX2
PROSITE profilePS512139.13298118IPR005539ELK domain
PROSITE profilePS5007111.645118181IPR001356Homeobox domain
SuperFamilySSF466893.76E-16120188IPR009057Homeodomain-like
SMARTSM003893.4E-11120185IPR001356Homeobox domain
CDDcd000862.23E-12121182No hitNo description
Gene3DG3DSA:1.10.10.604.4E-25125183IPR009057Homeodomain-like
PfamPF059202.2E-17138177IPR008422Homeobox KN domain
PfamPF013702.1E-10255389IPR001509NAD-dependent epimerase/dehydratase, N-terminal domain
Gene3DG3DSA:3.40.50.7205.7E-29255451IPR016040NAD(P)-binding domain
SuperFamilySSF517351.34E-30259485IPR016040NAD(P)-binding domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0016853Molecular Functionisomerase activity
GO:0050662Molecular Functioncoenzyme binding
Sequence ? help Back to Top
Protein Sequence    Length: 512 aa     Download sequence    Send to blast
MAQYLIVLCT FKEQLQQHVR VHAVEAVMAC RDIESTLQAL TGVSLGEGTG ATMSDDEDDL  60
QMDGSLDQSS ADGHDMMGFG PLLPTESERS LMERVRQELK IELKQGFKSR IEDVREEILR  120
KRRAGKLPGD TTSVLKAWWQ QHAKWPYPTE DDKAKLVEET GLQLKQINNW FINQRKRNWH  180
SNSQSVNSLK SKPYHCGLSV ETTECDSEVY GTAALSHIHG LPSQRRLCGP APKLPHLRPH  240
GLDWRPPRLP HSGSGRLENR ASLETDIALL KPSHVFNAAG VTGRPNVDWC ESHKVETIRT  300
NVIGTLTLAD VCRDHGLILI NYATGCIFEY DSDHPLGSGI GFKETDSPNF TGSFYSKTKA  360
MVEDLLKNYD NVCTLRVRMP ISSDLSNPRN FITKITRYEK VVDIPNSMTI LDELLPISIE  420
MGKRNLTGIW NFTNPGVVSH NEILEMYRDY VDPNFTWNNF TLEEQAKVIV APRSNNELDA  480
AKLKKEFPEL LSIKDSLIKY VFEPNQKVKA QV
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4qqr_A1e-167253511423003,5-epimerase/4-reductase
4qqr_B1e-167253511423003,5-epimerase/4-reductase
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtBifunctional enzyme involved in dTDP-beta-L-rhamnose biosynthesis. Catalyzes the epimerization of the C3' and C5'positions of dTDP-6-deoxy-4-keto-alpha-D-glucose to form dTDP-4-keto-beta-L-rhamnose and its reduction to yield dTDP-beta-L-rhamnose. Can form UDP-beta-L-rhamnose from UDP-6-deoxy-4-keto-alpha-D-glucose, but cannot convert GDP-4-dehydro-6-deoxy-D-mannose to GDP-fucose. {ECO:0000269|PubMed:15020741}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapKHN09737.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankBT0939000.0BT093900.1 Soybean clone JCVI-FLGm-17N4 unknown mRNA.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_028211060.10.0bifunctional dTDP-4-dehydrorhamnose 3,5-epimerase/dTDP-4-dehydrorhamnose reductase
SwissprotQ9LQ041e-167RMLCD_ARATH; Bifunctional dTDP-4-dehydrorhamnose 3,5-epimerase/dTDP-4-dehydrorhamnose reductase
TrEMBLA0A0L9TQ260.0A0A0L9TQ26_PHAAN; Uncharacterized protein
STRINGGLYMA17G14170.10.0(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF63483450
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G62990.11e-118KNOTTED-like homeobox of Arabidopsis thaliana 7
Publications ? help Back to Top
  1. Watt G,Leoff C,Harper AD,Bar-Peled M
    A bifunctional 3,5-epimerase/4-keto reductase for nucleotide-rhamnose synthesis in Arabidopsis.
    Plant Physiol., 2004. 134(4): p. 1337-46
    [PMID:15020741]
  2. Noir S,Bräutigam A,Colby T,Schmidt J,Panstruga R
    A reference map of the Arabidopsis thaliana mature pollen proteome.
    Biochem. Biophys. Res. Commun., 2005. 337(4): p. 1257-66
    [PMID:16242667]
  3. Holmes-Davis R,Tanaka CK,Vensel WH,Hurkman WJ,McCormick S
    Proteome mapping of mature pollen of Arabidopsis thaliana.
    Proteomics, 2005. 5(18): p. 4864-84
    [PMID:16247729]
  4. Oka T,Nemoto T,Jigami Y
    Functional analysis of Arabidopsis thaliana RHM2/MUM4, a multidomain protein involved in UDP-D-glucose to UDP-L-rhamnose conversion.
    J. Biol. Chem., 2007. 282(8): p. 5389-403
    [PMID:17190829]
  5. Marmagne A, et al.
    A high content in lipid-modified peripheral proteins and integral receptor kinases features in the arabidopsis plasma membrane proteome.
    Mol. Cell Proteomics, 2007. 6(11): p. 1980-96
    [PMID:17644812]
  6. Espagne C,Martinez A,Valot B,Meinnel T,Giglione C
    Alternative and effective proteomic analysis in Arabidopsis.
    Proteomics, 2007. 7(20): p. 3788-99
    [PMID:17828791]
  7. Ge W, et al.
    Proteomic analyses of apoplastic proteins from germinating Arabidopsis thaliana pollen.
    Biochim. Biophys. Acta, 2011. 1814(12): p. 1964-73
    [PMID:21798377]
  8. Fares A,Rossignol M,Peltier JB
    Proteomics investigation of endogenous S-nitrosylation in Arabidopsis.
    Biochem. Biophys. Res. Commun., 2011. 416(3-4): p. 331-6
    [PMID:22115780]
  9. Qi X, et al.
    Identification of a novel salt tolerance gene in wild soybean by whole-genome sequencing.
    Nat Commun, 2014. 5: p. 4340
    [PMID:25004933]
  10. Han X,Qian L,Zhang L,Liu X
    Structural and biochemical insights into nucleotide-rhamnose synthase/epimerase-reductase from Arabidopsis thaliana.
    Biochim. Biophys. Acta, 2015. 1854(10 Pt A): p. 1476-86
    [PMID:26116145]