PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID KHN09468.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Glycine; Soja
Family MYB_related
Protein Properties Length: 289aa    MW: 31684 Da    PI: 9.5672
Description MYB_related family protein
Gene Model
Gene Model ID Type Source Coding Sequence
KHN09468.1genomeTCUHKView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding43.38.4e-142670147
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47
                     r +W++eE++++++a +++  + Wk+I   +g  +t  q++s+ qky
       KHN09468.1 26 RESWSEEEHDKFLEALQLFDRD-WKKIEDFVG-SKTVIQIRSHAQKY 70
                     789*****************77.*********.*************9 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF466894.26E-172076IPR009057Homeodomain-like
PROSITE profilePS5129415.8492175IPR017930Myb domain
Gene3DG3DSA:1.10.10.601.1E-62476IPR009057Homeodomain-like
TIGRFAMsTIGR015573.0E-182473IPR006447Myb domain, plants
SMARTSM007172.2E-112573IPR001005SANT/Myb domain
PfamPF002491.5E-112670IPR001005SANT/Myb domain
CDDcd001674.45E-92871No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 289 aa     Download sequence    Send to blast
MAMAPSTSNS GSGKKVRKPY TITKSRESWS EEEHDKFLEA LQLFDRDWKK IEDFVGSKTV  60
IQIRSHAQKY FLKVQKNGAV AHVPPPRPKR KASHPYPQKA SKNVLLPLPA SMAYVSSTST  120
LPPGYVTWDE NSLLMNSGSN KSVPCNDELA YLLGNEADIG SKGITRIGHS SPSGVGNSTR  180
NLPATEMAKQ GKQAQVIHGL PDFAEVYSFI GSVFDPDTKG HVQKLKEMDP INFETVLLLM  240
KNLTVNLSSP DFEPVRKAMS SYDVNTNTVG VTAGIDVKKQ TNDLSCQTA
Functional Description ? help Back to Top
Source Description
UniProtTranscriptional activator of evening element (EE)-containing clock-controlled genes. Forms a negative feedback loop with APRR5. Regulates the pattern of histone H3 acetylation of the TOC1 promoter. {ECO:0000269|PubMed:21205033, ECO:0000269|PubMed:21474993, ECO:0000269|PubMed:21483796, ECO:0000269|PubMed:23638299}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapKHN09468.1
Regulation -- Description ? help Back to Top
Source Description
UniProtINDUCTION: Circadian-regulation. Peak of expression in the afternoon. Down-regulated by cold. {ECO:0000269|PubMed:21205033, ECO:0000269|PubMed:22902701, ECO:0000269|PubMed:23638299}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_028225783.10.0protein REVEILLE 8-like
SwissprotQ8RWU31e-131RVE8_ARATH; Protein REVEILLE 8
TrEMBLA0A3Q9B5G20.0A0A3Q9B5G2_SOYBN; ABAS1
TrEMBLA0A445LD290.0A0A445LD29_GLYSO; Protein REVEILLE 8 isoform A
STRINGGLYMA03G33440.20.0(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF67353449
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G09600.11e-133MYB_related family protein
Publications ? help Back to Top
  1. Manfield IW, et al.
    Arabidopsis Co-expression Tool (ACT): web server tools for microarray-based gene expression analysis.
    Nucleic Acids Res., 2006. 34(Web Server issue): p. W504-9
    [PMID:16845059]
  2. Ding Y, et al.
    Four distinct types of dehydration stress memory genes in Arabidopsis thaliana.
    BMC Plant Biol., 2013. 13: p. 229
    [PMID:24377444]
  3. Qi X, et al.
    Identification of a novel salt tolerance gene in wild soybean by whole-genome sequencing.
    Nat Commun, 2014. 5: p. 4340
    [PMID:25004933]
  4. Fogelmark K,Troein C
    Rethinking transcriptional activation in the Arabidopsis circadian clock.
    PLoS Comput. Biol., 2014. 10(7): p. e1003705
    [PMID:25033214]
  5. Xing H, et al.
    LNK1 and LNK2 recruitment to the evening element require morning expressed circadian related MYB-like transcription factors.
    Plant Signal Behav, 2015. 10(3): p. e1010888
    [PMID:25848708]
  6. Gray JA,Shalit-Kaneh A,Chu DN,Hsu PY,Harmer SL
    The REVEILLE Clock Genes Inhibit Growth of Juvenile and Adult Plants by Control of Cell Size.
    Plant Physiol., 2017. 173(4): p. 2308-2322
    [PMID:28254761]