PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID KHN08830.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Glycine; Soja
Family LBD
Protein Properties Length: 249aa    MW: 26723.5 Da    PI: 7.9251
Description LBD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
KHN08830.1genomeTCUHKView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF260133.39.3e-42461451100
      DUF260   1 aCaaCkvlrrkCakdCvlapyfpaeqpkkfanvhklFGasnvlkllkalpeeeredamsslvyeAearardPvyGavgvilklqqqleqlkaelallke 99 
                 +CaaCk+lrr+Ca++C+++pyf  ++p+kfa+vhk+FGasnv+k+l ++pe +r da++slvyeA+ r+rdPvyG++g i++lqqq+++l+ael+++++
  KHN08830.1  46 PCAACKLLRRRCAEECPFSPYFSPHEPQKFAAVHKVFGASNVSKMLMEVPEGQRADAANSLVYEANLRLRDPVYGCMGAISALQQQVQTLQAELNAIRA 144
                 7**********************************************************************************************9988 PP

      DUF260 100 e 100
                 e
  KHN08830.1 145 E 145
                 7 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5089125.52945146IPR004883Lateral organ boundaries, LOB
PfamPF031955.8E-4246143IPR004883Lateral organ boundaries, LOB
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0016020Cellular Componentmembrane
GO:0004088Molecular Functioncarbamoyl-phosphate synthase (glutamine-hydrolyzing) activity
Sequence ? help Back to Top
Protein Sequence    Length: 249 aa     Download sequence    Send to blast
MFGHPETDRL DEIITTARAE EEASSQMGRK HFYGPTPGTT LNTVTPCAAC KLLRRRCAEE  60
CPFSPYFSPH EPQKFAAVHK VFGASNVSKM LMEVPEGQRA DAANSLVYEA NLRLRDPVYG  120
CMGAISALQQ QVQTLQAELN AIRAEILKYK YREAASIISS QHVALVSSAD AISIAAIPAD  180
SSQGLSQPHA HPHPPPPKPL PSPLPKPLPS PSIILSSLSS SSASSVYTPP KSTMSLGSIS  240
TTANVPYFV
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5ly0_A2e-45391574122LOB family transfactor Ramosa2.1
5ly0_B2e-45391574122LOB family transfactor Ramosa2.1
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00283DAPTransfer from AT2G30340Download
Motif logo
Cis-element ? help Back to Top
SourceLink
PlantRegMapKHN08830.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAP0150361e-167AP015036.1 Vigna angularis var. angularis DNA, chromosome 3, almost complete sequence, cultivar: Shumari.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_003544924.10.0LOB domain-containing protein 13 isoform X1
RefseqXP_028199297.10.0LOB domain-containing protein 13-like isoform X1
SwissprotQ9AT613e-74LBD13_ARATH; LOB domain-containing protein 13
TrEMBLA0A0B2PI300.0A0A0B2PI30_GLYSO; LOB domain-containing protein 13
TrEMBLK7M8650.0K7M865_SOYBN; Uncharacterized protein
STRINGGLYMA14G38280.20.0(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF22983486
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G30340.17e-76LOB domain-containing protein 13
Publications ? help Back to Top
  1. Qi X, et al.
    Identification of a novel salt tolerance gene in wild soybean by whole-genome sequencing.
    Nat Commun, 2014. 5: p. 4340
    [PMID:25004933]
  2. Cho C,Jeon E,Pandey SK,Ha SH,Kim J
    LBD13 positively regulates lateral root formation in Arabidopsis.
    Planta, 2019. 249(4): p. 1251-1258
    [PMID:30627888]