PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID KHN08826.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Glycine; Soja
Family MYB_related
Protein Properties Length: 798aa    MW: 88756.9 Da    PI: 6.7894
Description MYB_related family protein
Gene Model
Gene Model ID Type Source Coding Sequence
KHN08826.1genomeTCUHKView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding24.56.2e-085496347
                     SS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
  Myb_DNA-binding  3 rWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47
                     +WT +E+e +  a +q G++ +++I ++++  +   q++++++ +
       KHN08826.1 54 AWTRQEEESFFTALRQVGKN-FEKITSRVQ-SKNKDQVRHYYYRL 96
                     6*****************99.*********.***********976 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF466891.57E-1047101IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.601.7E-54999IPR009057Homeodomain-like
PROSITE profilePS5129313.41650101IPR017884SANT domain
SMARTSM007172.7E-65199IPR001005SANT/Myb domain
CDDcd001677.31E-65497No hitNo description
PfamPF002495.6E-65496IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0016310Biological Processphosphorylation
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0016301Molecular Functionkinase activity
Sequence ? help Back to Top
Protein Sequence    Length: 798 aa     Download sequence    Send to blast
MEVEVPISLD LNNQLQPETV VSVQNGDPGV SSSVANGVNP QQPATKKPTR QWAAWTRQEE  60
ESFFTALRQV GKNFEKITSR VQSKNKDQVR HYYYRLVRRM NKLLGPGLCL DAKNSKDTNA  120
AMLRWWSLLE KYSCKASKLH LKPRRFKIFL EALEHQLLKD RKKNVRKRPL QGGNCLPAAP  180
TAVSNQSRAS GNDARAVKLV LVDNQNILKL GPSKPSTKRT VNMGVNHSNT KGDSNTMKPT  240
RQRKKSGTIS TAAYKKWEKA AIAGVSLVAD AAEHLERAAT VKEIEQDQEN PGERCSDPAD  300
YVLASLAKCP QKQFVDNNVN NSMKLKLQLF PIDEPTRRAL EMDKHNPHLE LTLSTRKKIS  360
SILEHLNRKW GNSSIAAGEV MLFPYGIQRE NLVNYPRWTQ ESTLSAADIY AMIGSPPIFR  420
LRYGWFSNTE FGLLNMQVPE ASGSMLRQYK SSVDNAKDPI VNSVSFPTPL TNTLSMELSE  480
DCRTSMNRNH TLMTASTDLS NARGNNVYLN TSTVESRDPT ANTPWHGKDV RDGAVTTQLE  540
DMDELKLSSG AGLSAGEWAD SLTNISVGDL LSGVSQDLDN CINPPIAESC YDVQQIPFSS  600
DSFDAAIAAH ISRHQDRMGR SSLASHMSSI WDAEETCDAF LFKKDPILQE YRPCLSPVAS  660
LESEKKVTKR SFDKLDELSP ERERLVDDCA QTDPMPMDSS ESDADVQEHL GKDFSALADM  720
YWPDSLGPLD LEIPSSTKYH SEDLIFSDSL SGLNRLIASS LDAFQNCSFF GFDKKEAPST  780
VEARESATLS DFKIGSGI
Cis-element ? help Back to Top
SourceLink
PlantRegMapKHN08826.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAC2358910.0AC235891.2 Glycine max clone GM_WBc0069F21, complete sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_028207225.10.0TSL-kinase interacting protein 1-like isoform X1
RefseqXP_028207226.10.0TSL-kinase interacting protein 1-like isoform X1
SwissprotQ8LJT80.0TKI1_ARATH; TSL-kinase interacting protein 1
TrEMBLA0A0B2PHK50.0A0A0B2PHK5_GLYSO; TSL-kinase interacting protein 1
STRINGGLYMA16G23840.10.0(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF98832531
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G36960.20.0TSL-kinase interacting protein 1
Publications ? help Back to Top
  1. Qi X, et al.
    Identification of a novel salt tolerance gene in wild soybean by whole-genome sequencing.
    Nat Commun, 2014. 5: p. 4340
    [PMID:25004933]