PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID KHN08786.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Glycine; Soja
Family G2-like
Protein Properties Length: 471aa    MW: 51123.1 Da    PI: 8.0384
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
KHN08786.1genomeTCUHKView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like101.74.7e-32283336255
     G2-like   2 prlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRl 55 
                 pr+rWt++LH+rFv+ave LGG+e+AtPk++lelm+vk+Ltl+hvkSHLQ+YR+
  KHN08786.1 283 PRMRWTSTLHARFVHAVELLGGHERATPKSVLELMDVKDLTLAHVKSHLQMYRT 336
                 9****************************************************7 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF466892.87E-15280336IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.602.0E-28281336IPR009057Homeodomain-like
TIGRFAMsTIGR015571.2E-23283336IPR006447Myb domain, plants
PfamPF002498.8E-7284335IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009887Biological Processorgan morphogenesis
GO:0009944Biological Processpolarity specification of adaxial/abaxial axis
GO:0009956Biological Processradial pattern formation
GO:0010051Biological Processxylem and phloem pattern formation
GO:0010158Biological Processabaxial cell fate specification
GO:0048481Biological Processplant ovule development
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 471 aa     Download sequence    Send to blast
MPLEGIFIEP TSTSTPDLSL HISPPSTSFS SSSICNNNNT SGGGGGINYE ARNSTSTNFP  60
SQAHIELSLG RNFSVGGGRG GGGVPEEPLP HHNNNINNNP YYQTQQAHFH HLQHHSNASR  120
ATTTTSTTTS SSNHMSHINY GVSLLDVSSE GLRPIKGIPV YHNRSFPFLP SEHSRDNKDH  180
HAKMCLYHHM PTYPSLSSSC SPLCSSSSSS SSPAAPYFAA AATATRFNGI SGEAFKSHHP  240
LHHHHSSSPH YGVGLGPSHE TSAGLMRSRF LPKLPAKRSM RAPRMRWTST LHARFVHAVE  300
LLGGHERATP KSVLELMDVK DLTLAHVKSH LQMYRTVKTT DKPAASSGLS DGSGEDDMSP  360
MGSSGGMRQF SDQRSLSDRP LQQDMDYSSG NNTLWSNSSS SRETWQQNNS NDVDGFRPPI  420
FQSQQISGGH QIQECDSTQL KNSLSGSNLE CKNPSLEFTL GRPDWNGKGQ A
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
17682GGRGGGG
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAP0150371e-176AP015037.1 Vigna angularis var. angularis DNA, chromosome 4, almost complete sequence, cultivar: Shumari.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006602023.10.0PREDICTED: transcription repressor KAN1-like isoform X2
SwissprotQ93WJ96e-75KAN1_ARATH; Transcription repressor KAN1
TrEMBLA0A0B2PHI30.0A0A0B2PHI3_GLYSO; Transcription repressor KAN1
STRINGGLYMA18G04880.20.0(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF17563391
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G16560.11e-61G2-like family protein
Publications ? help Back to Top
  1. Qi X, et al.
    Identification of a novel salt tolerance gene in wild soybean by whole-genome sequencing.
    Nat Commun, 2014. 5: p. 4340
    [PMID:25004933]