PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID KHN08691.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Glycine; Soja
Family HD-ZIP
Protein Properties Length: 279aa    MW: 31724.3 Da    PI: 6.587
Description HD-ZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
KHN08691.1genomeTCUHKView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox573.2e-1872125356
                 --SS--HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHHH CS
    Homeobox   3 kRttftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRakek 56 
                 k+++++ eq+++Le+ Fe  +++  e++ +LA+ lgL+ rq+ +WFqNrRa++k
  KHN08691.1  72 KKRRLNMEQVKTLEKSFELGNKLEPERKMQLARALGLQPRQIAIWFQNRRARWK 125
                 456899***********************************************9 PP

2HD-ZIP_I/II132.41.6e-4271161191
  HD-ZIP_I/II   1 ekkrrlskeqvklLEesFeeeekLeperKvelareLglqprqvavWFqnrRARtktkqlEkdyeaLkraydalkeenerLekeveeLreel 91 
                  ekkrrl+ eqvk+LE+sFe  +kLeperK++lar+Lglqprq+a+WFqnrRAR+ktkqlEkdy++Lkr+y+a+k++n++L++++++L++e+
   KHN08691.1  71 EKKRRLNMEQVKTLEKSFELGNKLEPERKMQLARALGLQPRQIAIWFQNRRARWKTKQLEKDYDVLKRQYEAVKSDNDALQAQNQKLQAEI 161
                  69**************************************************************************************987 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF466891.33E-1963129IPR009057Homeodomain-like
PROSITE profilePS5007117.39467127IPR001356Homeobox domain
SMARTSM003891.8E-1870131IPR001356Homeobox domain
PfamPF000461.5E-1572125IPR001356Homeobox domain
CDDcd000869.32E-1672128No hitNo description
Gene3DG3DSA:1.10.10.601.7E-1974134IPR009057Homeodomain-like
PRINTSPR000311.1E-598107IPR000047Helix-turn-helix motif
PROSITE patternPS000270102125IPR017970Homeobox, conserved site
PRINTSPR000311.1E-5107123IPR000047Helix-turn-helix motif
PfamPF021839.8E-17127167IPR003106Leucine zipper, homeobox-associated
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 279 aa     Download sequence    Send to blast
MLQTPHHDDH HHHQPPPSLT SILPTCAPQE YHGGVTILGK RSMSFSSGIE HGEEANNAEE  60
DLSDDGSQAG EKKRRLNMEQ VKTLEKSFEL GNKLEPERKM QLARALGLQP RQIAIWFQNR  120
RARWKTKQLE KDYDVLKRQY EAVKSDNDAL QAQNQKLQAE ILALKSREPT ESINLNKETE  180
GSCSNRSENS SDIKLDISRT PAIDSPHSTH QQQPSRPFFP PSSVRPAGVA QLFQTSSRPE  240
LASCQKIDQM VKEESLSNMF CGMDDQSGFW PWLEQQHFN
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1119127RRARWKTKQ
Functional Description ? help Back to Top
Source Description
UniProtProbable transcription factor that may act in the sucrose-signaling pathway. {ECO:0000269|PubMed:11292072}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapKHN08691.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankBT0988240.0BT098824.1 Soybean clone JCVI-FLGm-13G9 unknown mRNA.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006574451.10.0uncharacterized protein LOC100808033 isoform X2
RefseqXP_006574452.10.0uncharacterized protein LOC100808033 isoform X2
RefseqXP_028193312.10.0homeobox-leucine zipper protein ATHB-13-like isoform X2
RefseqXP_028193315.10.0homeobox-leucine zipper protein ATHB-13-like isoform X2
SwissprotQ8LC031e-115ATB13_ARATH; Homeobox-leucine zipper protein ATHB-13
TrEMBLA0A0B2PH710.0A0A0B2PH71_GLYSO; Homeobox-leucine zipper protein ATHB-13
TrEMBLA0A445LIH20.0A0A445LIH2_GLYSO; Homeobox-leucine zipper protein ATHB-13 isoform A
TrEMBLI1JBM80.0I1JBM8_SOYBN; Uncharacterized protein
STRINGGLYMA02G02290.10.0(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF127133106
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G69780.11e-107HD-ZIP family protein
Publications ? help Back to Top
  1. Ding Y, et al.
    Four distinct types of dehydration stress memory genes in Arabidopsis thaliana.
    BMC Plant Biol., 2013. 13: p. 229
    [PMID:24377444]
  2. Qi X, et al.
    Identification of a novel salt tolerance gene in wild soybean by whole-genome sequencing.
    Nat Commun, 2014. 5: p. 4340
    [PMID:25004933]
  3. Ribone PA,Capella M,Chan RL
    Functional characterization of the homeodomain leucine zipper I transcription factor AtHB13 reveals a crucial role in Arabidopsis development.
    J. Exp. Bot., 2015. 66(19): p. 5929-43
    [PMID:26136262]
  4. Wang X, et al.
    Overexpressed BRH1, a RING finger gene, alters rosette leaf shape in Arabidopsis thaliana.
    Sci China Life Sci, 2018. 61(1): p. 79-87
    [PMID:28887625]
  5. Ebrahimian-Motlagh S, et al.
    JUNGBRUNNEN1 Confers Drought Tolerance Downstream of the HD-Zip I Transcription Factor AtHB13.
    Front Plant Sci, 2017. 8: p. 2118
    [PMID:29326734]