PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID KHN08508.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Glycine; Soja
Family Dof
Protein Properties Length: 317aa    MW: 34097.7 Da    PI: 9.181
Description Dof family protein
Gene Model
Gene Model ID Type Source Coding Sequence
KHN08508.1genomeTCUHKView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1zf-Dof122.21.8e-383595262
      zf-Dof  2 kekalkcprCdstntkfCyynnyslsqPryfCkaCrryWtkGGalrnvPvGggrrknkkss 62
                +++ +kcprCds ntkfCyynnyslsqPryfCk+CrryWt+GG+lrnvPvGgg+rk k+++
  KHN08508.1 35 PQQPQKCPRCDSLNTKFCYYNNYSLSQPRYFCKTCRRYWTQGGTLRNVPVGGGCRKGKRAK 95
                67899***************************************************99875 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF027015.4E-333793IPR003851Zinc finger, Dof-type
PROSITE profilePS5088428.8353993IPR003851Zinc finger, Dof-type
ProDomPD0074781.0E-244093IPR003851Zinc finger, Dof-type
PROSITE patternPS0136104177IPR003851Zinc finger, Dof-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 317 aa     Download sequence    Send to blast
MEQRVGEGGG MNKQPRDSRV KEIQQGDAQV HAQAPQQPQK CPRCDSLNTK FCYYNNYSLS  60
QPRYFCKTCR RYWTQGGTLR NVPVGGGCRK GKRAKTSNSS SSSENINSSF RSLPLQQPQG  120
MVVQTQAPPL TSVVKAKDPS SVVASPFYQS GGYLSSLAAM HSLNPSSSHP FDQSLNVIAG  180
SDALRSSNLG LLSGFNVQRP IGQICPPYLY HQMGSDEREM VSLYEQGLVN PSSSSMANTN  240
TNTNGSGVSQ HDWPQSFINN NVSNRASDAS LWSTISTTIG GNSERTSTSG VGVDVGAGSS  300
SFVTNQWPNL PGYGPPP
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAC2352680.0AC235268.1 Glycine max strain Williams 82 clone GM_WBb0044I02, complete sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006594581.10.0PREDICTED: dof zinc finger protein PBF-like
TrEMBLA0A0B2PLJ30.0A0A0B2PLJ3_GLYSO; Dof zinc finger protein DOF5.3
TrEMBLI1M2210.0I1M221_SOYBN; Uncharacterized protein
STRINGGLYMA13G31110.10.0(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF41453258
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G60200.11e-32TARGET OF MONOPTEROS 6
Publications ? help Back to Top
  1. Qi X, et al.
    Identification of a novel salt tolerance gene in wild soybean by whole-genome sequencing.
    Nat Commun, 2014. 5: p. 4340
    [PMID:25004933]