PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID KHN08334.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Glycine; Soja
Family MYB_related
Protein Properties Length: 60aa    MW: 6987.05 Da    PI: 11.0885
Description MYB_related family protein
Gene Model
Gene Model ID Type Source Coding Sequence
KHN08334.1genomeTCUHKView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding35.72e-114401147
                     HHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
  Myb_DNA-binding 11 llvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47
                     l++++ + +G+g+Wk Iar+  k+Rt  q+ s+ qky
       KHN08334.1  4 LFLQGLAIYGKGDWKNIARYAVKTRTSTQVASHAQKY 40
                     79**********************************9 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129413.116145IPR017930Myb domain
CDDcd001674.12E-7341No hitNo description
TIGRFAMsTIGR015571.8E-11343IPR006447Myb domain, plants
SuperFamilySSF466893.04E-12345IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.601.1E-6440IPR009057Homeodomain-like
PfamPF002493.7E-8440IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 60 aa     Download sequence    Send to blast
HYRLFLQGLA IYGKGDWKNI ARYAVKTRTS TQVASHAQKY FLHLRASNKK GKRKSIYDTT
Functional Description ? help Back to Top
Source Description
UniProtTranscription activator that coordinates abscisic acid (ABA) biosynthesis and signaling-related genes via binding to the specific promoter motif 5'-(A/T)AACCAT-3'. Represses ABA-mediated salt (e.g. NaCl and KCl) stress tolerance. Regulates leaf shape and promotes vegetative growth. {ECO:0000269|PubMed:26243618}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapKHN08334.1
Regulation -- Description ? help Back to Top
Source Description
UniProtINDUCTION: Induced by salicylic acid (SA) and gibberellic acid (GA) (PubMed:16463103). Triggered by dehydration and salt stress (PubMed:26243618). {ECO:0000269|PubMed:16463103, ECO:0000269|PubMed:26243618}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006605600.12e-34myb-like protein J
SwissprotQ9FNN69e-19SRM1_ARATH; Transcription factor SRM1
TrEMBLA0A0B2PKU29e-36A0A0B2PKU2_GLYSO; Transcription factor MYB1R1 (Fragment)
STRINGXP_008806104.17e-22(Phoenix dactylifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF2019725
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G09450.11e-21MYB_related family protein
Publications ? help Back to Top
  1. Qi X, et al.
    Identification of a novel salt tolerance gene in wild soybean by whole-genome sequencing.
    Nat Commun, 2014. 5: p. 4340
    [PMID:25004933]
  2. Wang T, et al.
    Salt-Related MYB1 Coordinates Abscisic Acid Biosynthesis and Signaling during Salt Stress in Arabidopsis.
    Plant Physiol., 2015. 169(2): p. 1027-41
    [PMID:26243618]
  3. Chen YS, et al.
    Two MYB-related transcription factors play opposite roles in sugar signaling in Arabidopsis.
    Plant Mol. Biol., 2017. 93(3): p. 299-311
    [PMID:27866313]