PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID KHN08082.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Glycine; Soja
Family Nin-like
Protein Properties Length: 411aa    MW: 46428.6 Da    PI: 4.5829
Description Nin-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
KHN08082.1genomeTCUHKView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1RWP-RK54.32.6e-17310358452
      RWP-RK   4 eisledlskyFslpikdAAkeLgvclTvLKriCRqyGIkRWPhRkiksl 52 
                 +++l+dls  F+l+i +AA +L+v+ +++K iCR+  +kRWP+Rk++sl
  KHN08082.1 310 RMTLSDLSGVFHLTISAAAVKLDVGDSTVKSICRRGKLKRWPQRKVQSL 358
                 689*******************************************997 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5151914.493298379IPR003035RWP-RK domain
PfamPF020422.3E-16311358IPR003035RWP-RK domain
Sequence ? help Back to Top
Protein Sequence    Length: 411 aa     Download sequence    Send to blast
MDNNNNNYSG FVPNNDTDDD CTFLQTLLEL DPQHFYLPTE EFVSLSLQQQ QQNDPFGVEK  60
GNNVPFLQGK NNNDFPIGEG LVPDVVDVEE EGPPRRTGKE PILEGQGDRF FIHGHDIFFG  120
EGRVGNNVEP PQENQTQPPN NQDVRSLCSW PPPPEPFSCS CCEVLRQINY TNGVRFDKLE  180
IHGAVGVINH AICHVEDKTS NRPPRDTYQI IDFCNKNTEE IRNFLNVYCK ERTEAGFIPI  240
EDPSMSAFYD ALCTGMDWTE VSNDVDDDLG PPNGTEQESE SEPEAENGRR ASTSRPRRRD  300
MAVQRQRVPR MTLSDLSGVF HLTISAAAVK LDVGDSTVKS ICRRGKLKRW PQRKVQSLAK  360
KVRVLERALN SPDPGVKRRT LDEIRRLQQE IIENCGGITP TGIPMLQFDE E
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006606627.10.0PREDICTED: uncharacterized protein LOC102660093
RefseqXP_006606628.10.0PREDICTED: uncharacterized protein LOC102660219
TrEMBLA0A0B2PKG70.0A0A0B2PKG7_GLYSO; Uncharacterized protein
STRINGGLYMA20G02005.10.0(Glycine max)
STRINGGLYMA20G01991.10.0(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF74782846
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G35590.16e-07RWP-RK domain-containing protein
Publications ? help Back to Top
  1. Qi X, et al.
    Identification of a novel salt tolerance gene in wild soybean by whole-genome sequencing.
    Nat Commun, 2014. 5: p. 4340
    [PMID:25004933]