PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID KHN07800.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Glycine; Soja
Family MYB_related
Protein Properties Length: 234aa    MW: 27695.6 Da    PI: 9.9044
Description MYB_related family protein
Gene Model
Gene Model ID Type Source Coding Sequence
KHN07800.1genomeTCUHKView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding40.65.7e-1392136347
                      SS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
  Myb_DNA-binding   3 rWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                      +WT++E+ l++ + k +G+g+Wk I+++  k Rt  q+ s+ qky
       KHN07800.1  92 PWTEQEHRLFLLGLKIYGKGDWKNISKHCVKSRTHIQVASHAQKY 136
                      8*******************************************9 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS500905.169745IPR017877Myb-like domain
PROSITE profilePS5129413.83385141IPR017930Myb domain
Gene3DG3DSA:1.10.10.601.8E-987137IPR009057Homeodomain-like
SuperFamilySSF466891.17E-1688141IPR009057Homeodomain-like
SMARTSM007171.1E-689139IPR001005SANT/Myb domain
TIGRFAMsTIGR015571.1E-1491139IPR006447Myb domain, plants
CDDcd001672.46E-792137No hitNo description
PfamPF002492.0E-992136IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 234 aa     Download sequence    Send to blast
MWTRLQTQYF SSSEWTRSQN KVFPMFPEEE GEGQWEKVAE EIMKRYHQAL FRDTIHTEST  60
RVELPADSDD SPVDDARSPK SIRRRKGKSW KPWTEQEHRL FLLGLKIYGK GDWKNISKHC  120
VKSRTHIQVA SHAQKYFLRM KVTKKESKRK SIYDIALKDK HTELQRLQAQ NQERGMMQKN  180
SLDDFAIEFE ILVEDPSVID VEIAHIELTK LRGVRKVDLG KIDLVHHGRY VINF
Cis-element ? help Back to Top
SourceLink
PlantRegMapKHN07800.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_014618301.11e-175transcription factor DIVARICATA-like
RefseqXP_028184822.11e-175transcription factor DIVARICATA-like
TrEMBLA0A0B2PEU21e-173A0A0B2PEU2_GLYSO; Transcription factor MYB1R1
STRINGGLYMA10G24157.11e-126(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF1935635
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G04760.19e-33MYB family protein
Publications ? help Back to Top
  1. Qi X, et al.
    Identification of a novel salt tolerance gene in wild soybean by whole-genome sequencing.
    Nat Commun, 2014. 5: p. 4340
    [PMID:25004933]