PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID KHN07036.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Glycine; Soja
Family ARR-B
Protein Properties Length: 647aa    MW: 71150.5 Da    PI: 6.6379
Description ARR-B family protein
Gene Model
Gene Model ID Type Source Coding Sequence
KHN07036.1genomeTCUHKView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like30.11.1e-09204233130
     G2-like   1 kprlrWtpeLHerFveaveqLGGsekAtPk 30 
                 kpr++W+ eLH++Fv av+qLG    A P+
  KHN07036.1 204 KPRVVWSVELHRKFVAAVNQLGIDRGADPS 233
                 79*******************655556665 PP

2Response_reg75.42.1e-25201281109
                   EEEESSSHHHHHHHHHHHHHTTCEEEEEESSHHHHHHHHHHHH..ESEEEEESSCTTSEHHHHHHHHHHHTTTSEEEEEESTTTHHHHHHHHHTTES CS
  Response_reg   1 vlivdDeplvrellrqalekegyeevaeaddgeealellkekd..pDlillDiempgmdGlellkeireeepklpiivvtahgeeedalealkaGak 95 
                   vl vdD+p+ + +l+++l++ +y +++++ ++ +al+ll+e++  +Dl++ D+ mp+mdG++ll+     e++lp+i+++a+g+ +++ + ++ Ga 
    KHN07036.1  20 VLAVDDDPTCLLVLETLLRRCQY-HATTTNQAIKALALLREHKdkFDLVISDVHMPDMDGFKLLELVGL-EMDLPVIMLSANGDTKLVMKGISHGAC 114
                   799********************.***************999889*******************87754.558************************ PP

                   EEEESS--HHHHHH CS
  Response_reg  96 dflsKpfdpeelvk 109
                   d+l Kp+ +eel +
    KHN07036.1 115 DYLLKPVRMEELKN 128
                   ***********986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF521721.04E-3517141IPR011006CheY-like superfamily
Gene3DG3DSA:3.40.50.23003.5E-4217153No hitNo description
SMARTSM004484.0E-3118130IPR001789Signal transduction response regulator, receiver domain
PROSITE profilePS5011042.86819134IPR001789Signal transduction response regulator, receiver domain
PfamPF000721.5E-2220128IPR001789Signal transduction response regulator, receiver domain
CDDcd001561.01E-2621134No hitNo description
Gene3DG3DSA:1.10.10.601.4E-9201244IPR009057Homeodomain-like
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0000160Biological Processphosphorelay signal transduction system
GO:0005622Cellular Componentintracellular
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 647 aa     Download sequence    Send to blast
MTVEKKMNDS GDEFPVGMRV LAVDDDPTCL LVLETLLRRC QYHATTTNQA IKALALLREH  60
KDKFDLVISD VHMPDMDGFK LLELVGLEMD LPVIMLSANG DTKLVMKGIS HGACDYLLKP  120
VRMEELKNIW QHVIRRKKFD SKEKNKTRNI DKPTSNSSNG LGSSGTGNSD HNEKLTKKRK  180
DQDEDEDEEQ ENDHDNDDPS AQKKPRVVWS VELHRKFVAA VNQLGIDRGA DPSYLRMNSV  240
SGVGHIQSIS GSGQLHNNAF RSFPPSGIIN RLNTPAGLNV HGFPSGVLQL SQSQNLKNTN  300
DNLKFLSAIV PANQNGVHGM TVSVGLDQLQ NNKGVMSVQN LTTVFDAKTT FPISNKLPDP  360
RPKITNSGSH TPDVSFSNNA LMLEPRPQGT QGSVRIETLS SSVASQHSEF SLSLLDQGRY  420
SDNWASTVQP SVIQTNSYPP SECFGQTNIP PTDNMASVPL QGGNLSGASI TSLSRQSHDS  480
MTDMHSEGVT FTNRPGHISS NVPYQGWHDN NQDATHHSNI LSINSLTPVN GAAVPAGHAA  540
MNSALHRNLD FNYCDPLQMK HEGFVELADE ALSKQHQGNI MNLPKSQQSH FSNNLGSLED  600
LVSSMMKQEN DKMKLLDGNL ICNNYSGGLS RCDSRFSSTF QNIMHPR
Functional Description ? help Back to Top
Source Description
UniProtTranscriptional activator that binds specific DNA sequence. Functions as a response regulator involved in His-to-Asp phosphorelay signal transduction system. Phosphorylation of the Asp residue in the receiver domain activates the ability of the protein to promote the transcription of target genes. May directly activate some type-A response regulators in response to cytokinins. {ECO:0000250|UniProtKB:Q940D0}.
UniProtTranscriptional activator that binds specific DNA sequence. Functions as a response regulator involved in His-to-Asp phosphorelay signal transduction system. Phosphorylation of the Asp residue in the receiver domain activates the ability of the protein to promote the transcription of target genes. May directly activate some type-A response regulators in response to cytokinins. {ECO:0000250|UniProtKB:Q940D0}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapKHN07036.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankBT0938360.0BT093836.1 Soybean clone JCVI-FLGm-24O12 unknown mRNA.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_028235188.10.0two-component response regulator ARR12-like
SwissprotB8AEH11e-101ORR23_ORYSI; Two-component response regulator ORR23
SwissprotQ6K8X61e-101ORR23_ORYSJ; Two-component response regulator ORR23
TrEMBLA0A445K5I10.0A0A445K5I1_GLYSO; Two-component response regulator
STRINGGLYMA06G06730.10.0(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF95634112
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G25180.16e-94response regulator 12
Publications ? help Back to Top
  1. Kikuchi S, et al.
    Collection, mapping, and annotation of over 28,000 cDNA clones from japonica rice.
    Science, 2003. 301(5631): p. 376-9
    [PMID:12869764]
  2. Qi X, et al.
    Identification of a novel salt tolerance gene in wild soybean by whole-genome sequencing.
    Nat Commun, 2014. 5: p. 4340
    [PMID:25004933]