PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID KHN06404.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Glycine; Soja
Family G2-like
Protein Properties Length: 401aa    MW: 45847.8 Da    PI: 9.0064
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
KHN06404.1genomeTCUHKView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like100.31.3e-3182135255
     G2-like   2 prlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRl 55 
                 prlrWtpeLH +Fv+ave+LGG+e+AtPk +l+lm+v gL+++hvkSHLQ+YR+
  KHN06404.1  82 PRLRWTPELHLSFVHAVERLGGQERATPKLVLQLMNVRGLSIAHVKSHLQMYRS 135
                 8****************************************************7 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129412.21878138IPR017930Myb domain
Gene3DG3DSA:1.10.10.607.7E-3078136IPR009057Homeodomain-like
SuperFamilySSF466898.6E-1580136IPR009057Homeodomain-like
TIGRFAMsTIGR015571.7E-2282137IPR006447Myb domain, plants
PfamPF002493.0E-983134IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 401 aa     Download sequence    Send to blast
MSDEYERSEH ADDDSSMGSS QKCSSFDLNE EASSKDNNDN DDKGFEEARE EGTSTNKSSS  60
MTKEGSNERR GGVRQYVRSK MPRLRWTPEL HLSFVHAVER LGGQERATPK LVLQLMNVRG  120
LSIAHVKSHL QMYRSKKLDE AGQVLGQTYK STHELGRISH VAHQSMNPRQ HFKMGNGGII  180
LASDYNDHSY FHGLMHPCSL SHSHTKAIDS RRQQWYFNNH QPFRRPSYFS NEVVSSTALQ  240
TQGRSLSSNQ INLMDATSIA PMRPSQFLEE KKWPPLDIMN NHHWKKRLPA NITSNAVSQP  300
VVHQFGTTAA SLLRPSELNF GNNTRIKEHL SNSDEHRNYS NSFKLEFEPP FRIKSNQEKL  360
QKENQWAPDL RLSLSQRDGN NDGKTDHCRE TQEINTKLSL S
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_003524206.10.0PREDICTED: two-component response regulator ORR24-like
TrEMBLA0A0B2PFQ40.0A0A0B2PFQ4_GLYSO; Putative Myb family transcription factor
STRINGGLYMA05G29161.10.0(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF30123270
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G38300.14e-37G2-like family protein
Publications ? help Back to Top
  1. Qi X, et al.
    Identification of a novel salt tolerance gene in wild soybean by whole-genome sequencing.
    Nat Commun, 2014. 5: p. 4340
    [PMID:25004933]