PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID KHN06002.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Glycine; Soja
Family GRAS
Protein Properties Length: 350aa    MW: 39286.6 Da    PI: 5.9972
Description GRAS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
KHN06002.1genomeTCUHKView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GRAS42.88.1e-143484252
        GRAS  2 velLlecAeavssgdlelaqalLarlselaspdgdpmqRlaayfteALaar 52
                ++lL++cA+a++++d +laq++L+ l+++a pdgd++qRla+ f++AL a+
  KHN06002.1 34 EQLLVHCANAIETNDVTLAQQILWVLNNIAPPDGDSNQRLASGFLRALTAH 84
                79**********************************************875 PP

2GRAS150.31.9e-4694347158373
        GRAS 158 leetgerLakfAeelgvpfefnvl.......vakrledleleeLrvkp.............gEalaVnlvlqlhrll...................... 214
                 + e+g +L +fA++ ++ +ef+v+            +   +e+Lrv++              Eal++n++++lh+++                      
  KHN06002.1  94 YDELGAKLVNFARSRNMVMEFRVVsssyrdgF----AG-LIEHLRVQQqhfvyaaesrttpSEALVINCHMMLHYIPdetlsdttgltsflydssslaa 187
                 6799*******************855533331....22.3566655555555555666666*************************************9 PP

        GRAS 215 ...desvsleserdevLklvkslsPkvvvvveqeadhnsesFlerflealeyysalfdsleaklpreseerikvErellgreivnvvacegaerrerhe 310
                     + ++++s r+ +Lk +++l P+vv++v+++ad++s++++ r+ +a++y +  +d++++ lpr s++r+++E+  + ++i+nv+a+eg +r+er e
  KHN06002.1 188 ssaVSVTPTSSLRSLFLKSLRGLDPTVVILVDEDADLTSNNLVCRLRSAFNYLWIPYDTVDTFLPRGSKQRQWYEAD-ICWKIENVIAHEGVQRVERVE 285
                 98533444555899***************************************************************.********************* PP

        GRAS 311 tlekWrerleeaGFkpvplsekaakqaklllrkvksdgyrveeesgslvlgWkdrpLvsvSaW 373
                  +++W++r+++a F+ v++se+ ++++k++l +++  g+ +++e++ +vl+Wk++++v++SaW
  KHN06002.1 286 PKNRWEQRMKNASFQGVAFSEDSVAEVKAMLDEHA-AGWGLKKEDEHIVLTWKGHNVVFASAW 347
                 ***********************************.999************************ PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5098520.6461329IPR005202Transcription factor GRAS
PfamPF035142.8E-113484IPR005202Transcription factor GRAS
PfamPF035146.5E-4494347IPR005202Transcription factor GRAS
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
Sequence ? help Back to Top
Protein Sequence    Length: 350 aa     Download sequence    Send to blast
MNKNQIPRPR PWPAACFPTT SKALSNFGDA NCMEQLLVHC ANAIETNDVT LAQQILWVLN  60
NIAPPDGDSN QRLASGFLRA LTAHNIPPML DLSYDELGAK LVNFARSRNM VMEFRVVSSS  120
YRDGFAGLIE HLRVQQQHFV YAAESRTTPS EALVINCHMM LHYIPDETLS DTTGLTSFLY  180
DSSSLAASSA VSVTPTSSLR SLFLKSLRGL DPTVVILVDE DADLTSNNLV CRLRSAFNYL  240
WIPYDTVDTF LPRGSKQRQW YEADICWKIE NVIAHEGVQR VERVEPKNRW EQRMKNASFQ  300
GVAFSEDSVA EVKAMLDEHA AGWGLKKEDE HIVLTWKGHN VVFASAWLPA
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5b3g_B4e-1396349254474Protein SHORT-ROOT
5b3h_B3e-1396349200420Protein SHORT-ROOT
5b3h_E3e-1396349200420Protein SHORT-ROOT
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtProbable transcription factor involved in plant development. {ECO:0000250}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapKHN06002.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAC2358870.0AC235887.2 Glycine max clone GM_WBc0029N01, complete sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_028232172.10.0scarecrow-like protein 32
SwissprotQ9SN221e-96SCL32_ARATH; Scarecrow-like protein 32
TrEMBLA0A0B2PEI50.0A0A0B2PEI5_GLYSO; Scarecrow-like protein 32
STRINGGLYMA05G22140.10.0(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF77023347
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G49950.16e-91GRAS family protein
Publications ? help Back to Top
  1. Qi X, et al.
    Identification of a novel salt tolerance gene in wild soybean by whole-genome sequencing.
    Nat Commun, 2014. 5: p. 4340
    [PMID:25004933]