PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID KHN05594.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Glycine; Soja
Family MYB_related
Protein Properties Length: 92aa    MW: 10760.6 Da    PI: 10.3256
Description MYB_related family protein
Gene Model
Gene Model ID Type Source Coding Sequence
KHN05594.1genomeTCUHKView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding45.12.3e-141461148
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                     +grWTteE+e+l +++     g+W++ ++   + R++++c++rw +yl
       KHN05594.1 14 KGRWTTEEEEILTKYIMANAEGSWRSLPKNARLLRCGNNCRLRWINYL 61
                     79******************************99************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.601.3E-19564IPR009057Homeodomain-like
PROSITE profilePS5129416.132965IPR017930Myb domain
SMARTSM007171.2E-71363IPR001005SANT/Myb domain
PfamPF002497.0E-121461IPR001005SANT/Myb domain
SuperFamilySSF466891.2E-171590IPR009057Homeodomain-like
CDDcd001671.60E-51661No hitNo description
Gene3DG3DSA:1.10.10.603.5E-56591IPR009057Homeodomain-like
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 92 aa     Download sequence    Send to blast
MVRAHCCEKV GLKKGRWTTE EEEILTKYIM ANAEGSWRSL PKNARLLRCG NNCRLRWINY  60
LRADLKRGTF SVEEECTILK LNASFGSRLR RI
Functional Description ? help Back to Top
Source Description
UniProtTranscription factor postulated to regulate the biosynthetic pathway of a flavonoid-derived pigment in certain floral tissues.
Cis-element ? help Back to Top
SourceLink
PlantRegMapKHN05594.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankBT0942954e-61BT094295.1 Soybean clone JCVI-FLGm-18O14 unknown mRNA.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_003553664.19e-49transcription factor MYB111
RefseqXP_028217761.19e-49transcription factor MYB111-like
SwissprotP278985e-37MYBP_MAIZE; Myb-related protein P
TrEMBLA0A0B2PDK45e-60A0A0B2PDK4_GLYSO; Myb-related protein P
STRINGGLYMA19G24451.11e-54(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF3134817
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G47460.11e-31myb domain protein 12
Publications ? help Back to Top
  1. Robbins ML,Sekhon RS,Meeley R,Chopra S
    A Mutator transposon insertion is associated with ectopic expression of a tandemly repeated multicopy Myb gene pericarp color1 of maize.
    Genetics, 2008. 178(4): p. 1859-74
    [PMID:18430921]
  2. Sidorenko L,Chandler V
    RNA-dependent RNA polymerase is required for enhancer-mediated transcriptional silencing associated with paramutation at the maize p1 gene.
    Genetics, 2008. 180(4): p. 1983-93
    [PMID:18845841]
  3. Robbins ML,Wang P,Sekhon RS,Chopra S
    Gene structure induced epigenetic modifications of pericarp color1 alleles of maize result in tissue-specific mosaicism.
    PLoS ONE, 2009. 4(12): p. e8231
    [PMID:20011605]
  4. Rhee Y,Sekhon RS,Chopra S,Kaeppler S
    Tissue culture-induced novel epialleles of a Myb transcription factor encoded by pericarp color1 in maize.
    Genetics, 2010. 186(3): p. 843-55
    [PMID:20823340]
  5. Morohashi K, et al.
    A genome-wide regulatory framework identifies maize pericarp color1 controlled genes.
    Plant Cell, 2012. 24(7): p. 2745-64
    [PMID:22822204]
  6. Qi X, et al.
    Identification of a novel salt tolerance gene in wild soybean by whole-genome sequencing.
    Nat Commun, 2014. 5: p. 4340
    [PMID:25004933]