PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID KHN04907.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Glycine; Soja
Family Dof
Protein Properties Length: 337aa    MW: 36377 Da    PI: 8.8839
Description Dof family protein
Gene Model
Gene Model ID Type Source Coding Sequence
KHN04907.1genomeTCUHKView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1zf-Dof126.58.3e-403494262
      zf-Dof  2 kekalkcprCdstntkfCyynnyslsqPryfCkaCrryWtkGGalrnvPvGggrrknkkss 62
                +e+ lkcprCds ntkfCyynnysl+qPr+fCk+CrryWtkGGalrnvP+Ggg+rknkk++
  KHN04907.1 34 QEQGLKCPRCDSPNTKFCYYNNYSLTQPRHFCKTCRRYWTKGGALRNVPIGGGCRKNKKVK 94
                57899*****************************************************986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF027014.3E-333692IPR003851Zinc finger, Dof-type
ProDomPD0074781.0E-263792IPR003851Zinc finger, Dof-type
PROSITE profilePS5088429.4323892IPR003851Zinc finger, Dof-type
PROSITE patternPS0136104076IPR003851Zinc finger, Dof-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0010052Biological Processguard cell differentiation
GO:0010118Biological Processstomatal movement
GO:0045893Biological Processpositive regulation of transcription, DNA-templated
GO:1902066Biological Processregulation of cell wall pectin metabolic process
GO:0005634Cellular Componentnucleus
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 337 aa     Download sequence    Send to blast
MSPDDTPPPK PATAKDQETQ SSGGGRKSSS TRPQEQGLKC PRCDSPNTKF CYYNNYSLTQ  60
PRHFCKTCRR YWTKGGALRN VPIGGGCRKN KKVKSSRLSC DSKDSGSSSS ELGGLKFLHS  120
LSPSMDFHLG GLPFPRLHHH HPPTPYNHFS SFGDTSSASS CFNLDPSPGT TPSSSFAALN  180
NYPFSYNGAI QGMSSLNVHS GLASSIESLS SINQDLHWKL QQQRLAMLFG GDNNNQKDHS  240
GVNQIENLAQ KPQPIMFQNL EISKPGTFPV GNSRKEQGSS GDTHTPSTEW FFGNSYASVT  300
PTPTTSSGGP GNDNASNWSS GGVHAWGDVP QQYSALP
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAP0150430.0AP015043.1 Vigna angularis var. angularis DNA, chromosome 10, almost complete sequence, cultivar: Shumari.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_003517274.10.0PREDICTED: dof zinc finger protein DOF5.7-like
TrEMBLA0A0B2PBC70.0A0A0B2PBC7_GLYSO; Dof zinc finger protein DOF5.7
TrEMBLK7K1C70.0K7K1C7_SOYBN; Uncharacterized protein
STRINGGLYMA01G02610.20.0(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF38543460
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G60200.13e-34TARGET OF MONOPTEROS 6
Publications ? help Back to Top
  1. Qi X, et al.
    Identification of a novel salt tolerance gene in wild soybean by whole-genome sequencing.
    Nat Commun, 2014. 5: p. 4340
    [PMID:25004933]