PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID KHN04852.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Glycine; Soja
Family G2-like
Protein Properties Length: 375aa    MW: 42117 Da    PI: 9.5457
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
KHN04852.1genomeTCUHKView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like102.23.4e-32194247255
     G2-like   2 prlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRl 55 
                 pr+rWt++LH+rFv+ave LGG+e+AtPk++lelm+vk+Ltl+hvkSHLQ+YR+
  KHN04852.1 194 PRMRWTSTLHARFVHAVELLGGHERATPKSVLELMDVKDLTLAHVKSHLQMYRT 247
                 9****************************************************7 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF466891.97E-15191247IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.601.4E-28192247IPR009057Homeodomain-like
TIGRFAMsTIGR015578.8E-24194247IPR006447Myb domain, plants
PfamPF002496.4E-7195246IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009944Biological Processpolarity specification of adaxial/abaxial axis
GO:0048481Biological Processplant ovule development
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 375 aa     Download sequence    Send to blast
MELFPAQPDL SLQISPPNAN PTSSWRRSTE EDMDLGFWKR ALDSRNSIQS TMAKQDSCFD  60
LSLSNPKASD NNNSNLIHHH HFQTSNATTI INPFQLPFQQ NHFFHQQQQP LFQPQHQSLS  120
QDLGFLRPIR GIPVYQNPPP IPFTQHHHLP LEASTTTPSI ISNTNTGSTP FHSQALMRSR  180
FLSRFPAKRS MRAPRMRWTS TLHARFVHAV ELLGGHERAT PKSVLELMDV KDLTLAHVKS  240
HLQMYRTVKT TDRAAASSGQ SDVYDNGSSG DTSDDLMFDI KSSRRSDLSV KQGRSSVNQD  300
KKYHGLWGNS SREAWLHGKT KADSVGNVPS YLEKEMDPKC LSYERISDGS SSSNLSGSSP  360
KKPNLDLEFS LGQPL
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00174DAPTransfer from AT1G32240Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_007158256.10.0hypothetical protein PHAVU_002G137300g
SwissprotQ9C6162e-97KAN2_ARATH; Probable transcription factor KAN2
TrEMBLA0A0B2PB800.0A0A0B2PB80_GLYSO; Putative transcription factor KAN2
STRINGGLYMA09G34030.20.0(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF59683452
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G32240.11e-76G2-like family protein
Publications ? help Back to Top
  1. Qi X, et al.
    Identification of a novel salt tolerance gene in wild soybean by whole-genome sequencing.
    Nat Commun, 2014. 5: p. 4340
    [PMID:25004933]