PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID KHN04740.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Glycine; Soja
Family MYB_related
Protein Properties Length: 161aa    MW: 18556.1 Da    PI: 9.8268
Description MYB_related family protein
Gene Model
Gene Model ID Type Source Coding Sequence
KHN04740.1genomeTCUHKView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding43.29.3e-1482127247
                      SSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
  Myb_DNA-binding   2 grWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                      ++WT+ E++ ++ + k lG+g+Wk I++    ++t+ q+ s+ qky
       KHN04740.1  82 KPWTEKEHKDFLSGLKHLGKGNWKEISKNYVRTKTPTQVASHAQKY 127
                      58*****************************9*************9 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129413.95476132IPR017930Myb domain
SuperFamilySSF466894.86E-1678131IPR009057Homeodomain-like
TIGRFAMsTIGR015575.5E-1780130IPR006447Myb domain, plants
SMARTSM007172.0E-980130IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.601.9E-980126IPR009057Homeodomain-like
PfamPF002496.4E-1282127IPR001005SANT/Myb domain
CDDcd001673.20E-883128No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 161 aa     Download sequence    Send to blast
MMKETMTCNE KSEGCLMLFG VNILAKNPIR DGVPKCSSML NRSYCHGEEE INANKENSEG  60
GYLSDVLVQQ RHNFHDKKNK GKPWTEKEHK DFLSGLKHLG KGNWKEISKN YVRTKTPTQV  120
ASHAQKYFLR IGAIETRKRR RSLFDIPLEE DGTSKVFRDS H
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1136140RKRRR
2136141RKRRRS
Functional Description ? help Back to Top
Source Description
UniProtProbable transcription factor involved in somatic embryogenesis. Acts as positive regulator of BHLH109. {ECO:0000269|PubMed:26973252}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapKHN04740.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAP0150411e-43AP015041.1 Vigna angularis var. angularis DNA, chromosome 8, almost complete sequence, cultivar: Shumari.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_028184801.11e-115probable transcription factor At5g61620
SwissprotQ9FKF94e-32M5162_ARATH; Probable transcription factor At5g61620
TrEMBLA0A0B2P6541e-118A0A0B2P654_GLYSO; Putative transcription factor
TrEMBLK7LIU81e-118K7LIU8_SOYBN; Uncharacterized protein
STRINGGLYMA10G23084.11e-118(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF1686178
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G61620.12e-34MYB_related family protein
Publications ? help Back to Top
  1. Qi X, et al.
    Identification of a novel salt tolerance gene in wild soybean by whole-genome sequencing.
    Nat Commun, 2014. 5: p. 4340
    [PMID:25004933]
  2. Nowak K,Gaj MD
    Stress-related function of bHLH109 in somatic embryo induction in Arabidopsis.
    J. Plant Physiol., 2016. 193: p. 119-26
    [PMID:26973252]