PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID KHN04335.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Glycine; Soja
Family YABBY
Protein Properties Length: 214aa    MW: 23919.3 Da    PI: 7.5558
Description YABBY family protein
Gene Model
Gene Model ID Type Source Coding Sequence
KHN04335.1genomeTCUHKView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1YABBY229.49.3e-71111782170
       YABBY   2 dvfssseqvCyvqCnfCntilavsvPstslfkvvtvrCGhCtsllsvnlakasqllaaeshldeslkeelleelkveeenlksnvekeesastsvssek 100
                 d+   seq+Cyv+Cn C+t+lavsvP tslfk+vtvrCGhCt+ll vn++      +++ hl++s+  + ++ l+   +      +++++ s+s++ ++
  KHN04335.1  11 DHLPPSEQLCYVHCNICDTVLAVSVPCTSLFKTVTVRCGHCTNLLPVNMRGLLMPSPTQFHLGHSFFSPSHNLLEEIPNPSPNFLMNQTNLSASNEFSM 109
                 577899***********************************************************9988666665555555555555555555555544 PP

       YABBY 101 lsenedeevprvppvirPPekrqrvPsaynrfikeeiqrikasnPdishreafsaaaknWahfPkihfgl 170
                   +   +e+pr p ++rPPekrqrvPsaynrfik+eiqrik+ nPdi+hreafsaaaknWahfP+ihfgl
  KHN04335.1 110 PARIAADELPR-PIMNRPPEKRQRVPSAYNRFIKDEIQRIKSVNPDITHREAFSAAAKNWAHFPHIHFGL 178
                 45667778887.668*****************************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF046901.4E-6915178IPR006780YABBY protein
SuperFamilySSF470951.44E-7121171IPR009071High mobility group box domain
Gene3DG3DSA:1.10.30.104.5E-4127170IPR009071High mobility group box domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0007275Biological Processmulticellular organism development
Sequence ? help Back to Top
Protein Sequence    Length: 214 aa     Download sequence    Send to blast
MSSSSTTLSL DHLPPSEQLC YVHCNICDTV LAVSVPCTSL FKTVTVRCGH CTNLLPVNMR  60
GLLMPSPTQF HLGHSFFSPS HNLLEEIPNP SPNFLMNQTN LSASNEFSMP ARIAADELPR  120
PIMNRPPEKR QRVPSAYNRF IKDEIQRIKS VNPDITHREA FSAAAKNWAH FPHIHFGLMP  180
DQTVKKTNVC QQEGEEVLMK DGFYASANVG VSPY
Functional Description ? help Back to Top
Source Description
UniProtMay be involved in leaf cell growth and differentiation, rather than abaxial cell fate determination. {ECO:0000250}.
UniProtMay be involved in leaf cell growth and differentiation, rather than abaxial cell fate determination. {ECO:0000269|PubMed:17351053}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapKHN04335.1
Regulation -- Description ? help Back to Top
Source Description
UniProtINDUCTION: Repressed by WOX3. {ECO:0000269|PubMed:17351053}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankFJ6172721e-167FJ617272.1 Lotus japonicus YABBY1 protein (YABBY1) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqNP_001344728.11e-160protein YABBY 7 isoform 1
RefseqXP_028231726.11e-160protein YABBY 4-like isoform X1
SwissprotQ01JG21e-80YAB5_ORYSI; Protein YABBY 5
SwissprotQ0JBF01e-80YAB5_ORYSJ; Protein YABBY 5
TrEMBLA0A0B2P5391e-159A0A0B2P539_GLYSO; Protein YABBY 5
TrEMBLI1K0L11e-159I1K0L1_SOYBN; Uncharacterized protein
STRINGGLYMA05G04260.11e-159(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF20403490
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G45190.19e-82YABBY family protein
Publications ? help Back to Top
  1. Kikuchi S, et al.
    Collection, mapping, and annotation of over 28,000 cDNA clones from japonica rice.
    Science, 2003. 301(5631): p. 376-9
    [PMID:12869764]
  2. Qi X, et al.
    Identification of a novel salt tolerance gene in wild soybean by whole-genome sequencing.
    Nat Commun, 2014. 5: p. 4340
    [PMID:25004933]
  3. Khanday I, et al.
    Genome-Wide Targets Regulated by the OsMADS1 Transcription Factor Reveals Its DNA Recognition Properties.
    Plant Physiol., 2016. 172(1): p. 372-88
    [PMID:27457124]