PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID KHN03893.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Glycine; Soja
Family MYB_related
Protein Properties Length: 312aa    MW: 36341.1 Da    PI: 5.9435
Description MYB_related family protein
Gene Model
Gene Model ID Type Source Coding Sequence
KHN03893.1genomeTCUHKView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding42.41.6e-131056147
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47
                     r rWT+eE+ l++ + +++G+ +W+ Ia+++ +++t+ q+ s+ qk+
       KHN03893.1 10 RTRWTEEEHRLFLIGMERFGKSNWTNIAQHVVLTKTPSQVASHAQKF 56
                     78*******************************************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129416.418161IPR017930Myb domain
SuperFamilySSF466891.22E-15662IPR009057Homeodomain-like
TIGRFAMsTIGR015571.6E-14859IPR006447Myb domain, plants
SMARTSM007172.5E-7959IPR001005SANT/Myb domain
PfamPF002498.3E-111055IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.605.3E-91052IPR009057Homeodomain-like
CDDcd001673.95E-81257No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 312 aa     Download sequence    Send to blast
MPQLQRRNTR TRWTEEEHRL FLIGMERFGK SNWTNIAQHV VLTKTPSQVA SHAQKFFLHH  60
SSVKQSKRQR KIPSIHDITL VSQPVSQHNP VNDQLAEKLH VVPSQQLTDF EGCLAIHLND  120
QLSRPPSTMA QDLQIQQLPH FVDHDSWVST PNQQVPKLPH NLLDQDKWIP PLGLQIHQFS  180
DLIDDHIDLA PLPDLLELPL PYLPLPHHLD QEKWIPPQDL QTHQLPHFMD HDNWVSTPNQ  240
QFPELPHHLL DQENWTPPLD LEIHQFSDFI DDPLDLDPLH DLLELPLPDL LLKLSHHLDQ  300
EKWIPPPNSP IS
Cis-element ? help Back to Top
SourceLink
PlantRegMapKHN03893.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006593764.10.0probable transcription factor At5g61620 isoform X1
RefseqXP_028196912.10.0probable transcription factor At5g61620
TrEMBLA0A0B2P8840.0A0A0B2P884_GLYSO; Transcription factor DIVARICATA
TrEMBLI1LXA50.0I1LXA5_SOYBN; Uncharacterized protein
STRINGGLYMA13G09060.10.0(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF3608422
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G04760.12e-19MYB family protein
Publications ? help Back to Top
  1. Qi X, et al.
    Identification of a novel salt tolerance gene in wild soybean by whole-genome sequencing.
    Nat Commun, 2014. 5: p. 4340
    [PMID:25004933]