PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID KHN03659.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Glycine; Soja
Family ARR-B
Protein Properties Length: 698aa    MW: 76222.1 Da    PI: 5.6535
Description ARR-B family protein
Gene Model
Gene Model ID Type Source Coding Sequence
KHN03659.1genomeTCUHKView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like90.41.6e-28206259155
     G2-like   1 kprlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRl 55 
                 k+r++W+ eLH++Fv av+qL G +kA+Pk+il+lm+v+gLt+e+v+SHLQkYRl
  KHN03659.1 206 KARVVWSVELHRKFVAAVNQL-GLDKAVPKKILDLMNVEGLTRENVASHLQKYRL 259
                 68*******************.********************************8 PP

2Response_reg83.56.4e-28211291109
                   EEEESSSHHHHHHHHHHHHHTTCEEEEEESSHHHHHHHHHHHH..ESEEEEESSCTTSEHHHHHHHHHHHTTTSEEEEEESTTTHHHHHHHHHTTES CS
  Response_reg   1 vlivdDeplvrellrqalekegyeevaeaddgeealellkekd..pDlillDiempgmdGlellkeireeepklpiivvtahgeeedalealkaGak 95 
                   vl vdD+p+ +++l+++l+k +y +v+++ ++ eal++l+e++  +Dl++ D++mp++dG++ll+     e++lp+i+++ahg+ +++ + +  Ga 
    KHN03659.1  21 VLAVDDDPICLKVLENLLRKCQY-HVTTTNQAVEALTMLRENRnkFDLVISDVNMPDIDGFKLLELVGL-EMDLPVIMLSAHGDTKLVMKGVTHGAC 115
                   799********************.***************999889*******************87754.558************************ PP

                   EEEESS--HHHHHH CS
  Response_reg  96 dflsKpfdpeelvk 109
                   d+l Kp+ +eel +
    KHN03659.1 116 DYLLKPVRIEELKN 129
                   ***********987 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PIRSFPIRSF0363928.2E-1641698IPR017053Response regulator B-type, plant
Gene3DG3DSA:3.40.50.23001.2E-4218152No hitNo description
SuperFamilySSF521725.69E-3618142IPR011006CheY-like superfamily
SMARTSM004481.4E-3319131IPR001789Signal transduction response regulator, receiver domain
PROSITE profilePS5011043.84320135IPR001789Signal transduction response regulator, receiver domain
PfamPF000725.2E-2521129IPR001789Signal transduction response regulator, receiver domain
CDDcd001561.76E-2822134No hitNo description
PROSITE profilePS5129412.025203262IPR017930Myb domain
Gene3DG3DSA:1.10.10.604.6E-30203263IPR009057Homeodomain-like
SuperFamilySSF466891.27E-19204263IPR009057Homeodomain-like
TIGRFAMsTIGR015571.3E-24206259IPR006447Myb domain, plants
PfamPF002491.2E-7208258IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0000160Biological Processphosphorelay signal transduction system
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 698 aa     Download sequence    Send to blast
MAVENQREDG GCDRFPVGMR VLAVDDDPIC LKVLENLLRK CQYHVTTTNQ AVEALTMLRE  60
NRNKFDLVIS DVNMPDIDGF KLLELVGLEM DLPVIMLSAH GDTKLVMKGV THGACDYLLK  120
PVRIEELKNI WQHVVRRKNF DSRDQNKASN EEKAPNFAGG GSQGLRSENS ADQNKRLGKK  180
RKDQSDEEEE GGEENEDDED PSAQKKARVV WSVELHRKFV AAVNQLGLDK AVPKKILDLM  240
NVEGLTRENV ASHLQKYRLY LKKAAQQANM VAALGGSDSY LRIGSIDGYG DFCTSSGSGR  300
ITNATLPSYA STGIFSRLNS PAALNMRGIS SSALIRPVQS QNINSSLNTL GNIQPSIFPA  360
NQSSSLLQGI PTSIELNQSK QRNCTTGISQ LSQVDSSGFT VASGFPDHRA TVNGPNNSLP  420
CVSNNHIMLQ GNPQTHGPGA FSNQSSVRAA SLCAESFDVG LCGSSNLLDH NRCNDNWQNA  480
AQLSKFPANS LPLCEAFSND QLPPTSINDS NSSTHIGNNS PVDFSSRMGI SVPLEDTRNE  540
LRCQEGLIGN IVQPSSYTPR QRWEEHKLDY NQNMSCPFNS VNSHASSSGV TSSMGHVLNQ  600
NNTICSNRVD ASSLVGQLNG ASPSISRCTE VEKFSSDIRL KPNEAYILEQ MKSQDGFMQN  660
TFGTLDDIMG VMVKREQNES TLLDGEMGFD AYPVGSCN
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1irz_A2e-24202265164ARR10-B
Search in ModeBase
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1174182KRLGKKRKD
Functional Description ? help Back to Top
Source Description
UniProtTranscriptional activator that binds specific DNA sequence. Functions as a response regulator involved in His-to-Asp phosphorelay signal transduction system. Phosphorylation of the Asp residue in the receiver domain activates the ability of the protein to promote the transcription of target genes. May directly activate some type-A response regulators in response to cytokinins. {ECO:0000250|UniProtKB:Q940D0}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapKHN03659.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankBT0942040.0BT094204.1 Soybean clone JCVI-FLGm-18G16 unknown mRNA.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_003533888.20.0two-component response regulator ARR12 isoform X1
RefseqXP_028180904.10.0two-component response regulator ARR12-like
SwissprotQ6K8X61e-142ORR23_ORYSJ; Two-component response regulator ORR23
TrEMBLA0A0B2P7U30.0A0A0B2P7U3_GLYSO; Two-component response regulator ARR12
TrEMBLI1L2E20.0I1L2E2_SOYBN; Uncharacterized protein
STRINGGLYMA09G14650.10.0(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF95634112
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G25180.11e-131response regulator 12
Publications ? help Back to Top
  1. Kikuchi S, et al.
    Collection, mapping, and annotation of over 28,000 cDNA clones from japonica rice.
    Science, 2003. 301(5631): p. 376-9
    [PMID:12869764]
  2. Qi X, et al.
    Identification of a novel salt tolerance gene in wild soybean by whole-genome sequencing.
    Nat Commun, 2014. 5: p. 4340
    [PMID:25004933]