PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID KHN03530.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Glycine; Soja
Family GRAS
Protein Properties Length: 545aa    MW: 60881.5 Da    PI: 6.5015
Description GRAS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
KHN03530.1genomeTCUHKView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GRAS409.53.2e-1251775454374
        GRAS   4 lLlecAeavssgdlelaqalLar.lselaspdgdpmqRlaayfteALaarlarsvselykalppsetseknsseelaalklfsevsPilkfshltaNqa 101
                 +L  cA+avs++d   a+  + + l +l+s +gdp+qRl ay++e+L+arl +s++ +yk+l++++ +   s+e +++++++++++P+ kf+++ aN  
  KHN03530.1 177 ALKVCAQAVSDDDVPTARGWIDNvLGKLVSVSGDPIQRLGAYLLEGLRARLESSGNLIYKSLKCEQPT---SKELMSYMHILYQICPYWKFAYISANAI 272
                 6888**************9997527888***************************************9...99999*********************** PP

        GRAS 102 IleavegeervHiiDfdisqGlQWpaLlqaLasRpegppslRiTgvgspesg..skeeleetgerLakfAeelgvpfefnvlvakrledleleeLrvkp 198
                 I e +++e+r+HiiDf+i qG+QW  L+qaLa Rp+gppslR+Tgv++++s+  +   l  +gerL++fA+++gvpfef+  +a +  ++   +++++ 
  KHN03530.1 273 IQETMANESRIHIIDFQIAQGTQWHLLIQALAHRPGGPPSLRVTGVDDSQSThaRGGGLWIVGERLSDFARSCGVPFEFHS-AAISGCEVVRGNIEIRA 370
                 ************************************************9988888999***********************.56666777799****** PP

        GRAS 199 gEalaVnlvlqlhrlldesvsleserdevLklvkslsPkvvvvveqeadhnsesFlerflealeyysalfdsleaklpreseerikvErellgreivnv 297
                 gEalaVn+ + lh+++desvs+e++rd++L+lvkslsPkvv++veqe+++n+++F++rf+e+l+yy+a+f+s+++  pr++++ri+ E+++++r+ vn+
  KHN03530.1 371 GEALAVNFPYVLHHMPDESVSTENHRDRLLRLVKSLSPKVVTFVEQESNTNTSPFFQRFVETLDYYTAMFESIDVACPRDDKKRISAEQHCVARDMVNM 469
                 *************************************************************************************************** PP

        GRAS 298 vacegaerrerhetlekWrerleeaGFkpvplsekaakqaklllrkvksdgyrveeesgslvlgWkdrpLvsvSaWr 374
                 +aceg er+erhe ++kWr+rl++aGFk+ +ls++++  ++ ll++++++ yr+e+++g+l+lgW++r + + SaWr
  KHN03530.1 470 IACEGVERVERHELFGKWRSRLSMAGFKQCQLSSSVMVAIQNLLKEFSQN-YRLEHRDGALYLGWMNRHMATSSAWR 545
                 ************************************************66.*************************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5098563.421148526IPR005202Transcription factor GRAS
PfamPF035141.1E-122177545IPR005202Transcription factor GRAS
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
Sequence ? help Back to Top
Protein Sequence    Length: 545 aa     Download sequence    Send to blast
MQTSQKHPSS AGAHFYHQPV QGIYQMLQSN LCQDSSSQGT SVSFETCKEQ YFTLESCPAP  60
TNDFMDCDDS PSYASVSSKR TPFSPQGSQS CYSDHHQSSD NTYGSPISGL SSVDDRHQLK  120
HKLRELEISL LAPEESDITD SCGCCVVKGG LHGSSQLAKH NWDQIAENIA QFDLKGALKV  180
CAQAVSDDDV PTARGWIDNV LGKLVSVSGD PIQRLGAYLL EGLRARLESS GNLIYKSLKC  240
EQPTSKELMS YMHILYQICP YWKFAYISAN AIIQETMANE SRIHIIDFQI AQGTQWHLLI  300
QALAHRPGGP PSLRVTGVDD SQSTHARGGG LWIVGERLSD FARSCGVPFE FHSAAISGCE  360
VVRGNIEIRA GEALAVNFPY VLHHMPDESV STENHRDRLL RLVKSLSPKV VTFVEQESNT  420
NTSPFFQRFV ETLDYYTAMF ESIDVACPRD DKKRISAEQH CVARDMVNMI ACEGVERVER  480
HELFGKWRSR LSMAGFKQCQ LSSSVMVAIQ NLLKEFSQNY RLEHRDGALY LGWMNRHMAT  540
SSAWR
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5hyz_A2e-5420854536375GRAS family transcription factor containing p
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankBT0977040.0BT097704.1 Soybean clone JCVI-FLGm-22M20 unknown mRNA.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_003549525.10.0PREDICTED: scarecrow-like protein 13
SwissprotQ9M0M50.0SCL13_ARATH; Scarecrow-like protein 13
TrEMBLA0A0B2P2P30.0A0A0B2P2P3_GLYSO; Scarecrow-like protein 13
STRINGGLYMA17G01150.10.0(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF43773360
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G17230.10.0SCARECROW-like 13
Publications ? help Back to Top
  1. Qi X, et al.
    Identification of a novel salt tolerance gene in wild soybean by whole-genome sequencing.
    Nat Commun, 2014. 5: p. 4340
    [PMID:25004933]