PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID KHN03257.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Glycine; Soja
Family MYB_related
Protein Properties Length: 279aa    MW: 31305.4 Da    PI: 4.634
Description MYB_related family protein
Gene Model
Gene Model ID Type Source Coding Sequence
KHN03257.1genomeTCUHKView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding53.94.1e-172370148
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                     rg+WT +Ed+ l+++++ +G g+W+t a   g++Rt+k+c++rw++yl
       KHN03257.1 23 RGPWTVDEDLTLINYIATHGEGRWNTLALSAGLKRTGKSCRLRWLNYL 70
                     89********************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.601.0E-201573IPR009057Homeodomain-like
PROSITE profilePS5129422.4741874IPR017930Myb domain
SMARTSM007176.2E-142272IPR001005SANT/Myb domain
PfamPF002498.8E-162370IPR001005SANT/Myb domain
SuperFamilySSF466892.06E-212497IPR009057Homeodomain-like
CDDcd001671.04E-112570No hitNo description
PROSITE profilePS500904.64671117IPR017877Myb-like domain
Gene3DG3DSA:1.10.10.605.1E-67497IPR009057Homeodomain-like
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 279 aa     Download sequence    Send to blast
MDEKGARSSN TLLSCEDEMD LRRGPWTVDE DLTLINYIAT HGEGRWNTLA LSAGLKRTGK  60
SCRLRWLNYL RPDVRRGNIT LEEQLLILEL HSRWGNRTPC VTFGCQGSWN AFKQRRRPPT  120
TVTAAATNNA FTYGNNLNNN KFEVLNHKGR MGLTDPSVAN NDFVGSHVTQ SYTTPENSST  180
GASSSDSFGT QVSTISDLTE YYSVPENTNS ADYYQPSQIS NYSDNCITSP SGFLFPQGLD  240
LQSMDPNTPW NMQSGDSSDN FWDVESMLFL EQQLMNDNM
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1h8a_C2e-13209724100MYB TRANSFORMING PROTEIN
Search in ModeBase
Cis-element ? help Back to Top
SourceLink
PlantRegMapKHN03257.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankBT0937111e-168BT093711.1 Soybean clone JCVI-FLGm-17N7 unknown mRNA.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_003550902.11e-156transcription factor MYB108
RefseqXP_028209406.11e-156transcription factor MYB108
TrEMBLA0A445G1D01e-155A0A445G1D0_GLYSO; Transcription factor MYB78
TrEMBLK7MJT51e-155K7MJT5_SOYBN; Uncharacterized protein
STRINGGLYMA17G04171.11e-155(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF87534125
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G06490.14e-40myb domain protein 108
Publications ? help Back to Top
  1. Qi X, et al.
    Identification of a novel salt tolerance gene in wild soybean by whole-genome sequencing.
    Nat Commun, 2014. 5: p. 4340
    [PMID:25004933]