PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID KHN02610.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Glycine; Soja
Family EIL
Protein Properties Length: 742aa    MW: 81290.8 Da    PI: 8.3633
Description EIL family protein
Gene Model
Gene Model ID Type Source Coding Sequence
KHN02610.1genomeTCUHKView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1EIN3355.21.3e-10814217353
                 XXXXXXXXXXXXXXXXX..XXXXX.XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX CS
        EIN3   7 mwkdqmllkrlkerkkqlledkeaatgakksnksneqarrkkmsraQDgiLkYMlkemevcnaqGfvYgiipekgkpvegasdsLraWWkekvefdrng 105
                 mw+d+mll++lk+++k+    +e       + k+ e +++k+  raQD +Lk Mlk+mevc ++GfvYgiipekgkpv+gasd+L +WWke v+fdrng
  KHN02610.1   1 MWRDRMLLRKLKDERKE----RE-------QGKTVEMMKKKALTRAQDIVLKNMLKMMEVCDVRGFVYGIIPEKGKPVSGASDNLPGWWKERVKFDRNG 88 
                 9********99988886....23.......3367899************************************************************** PP

                 XXXXXXXXXXXXXXXXXXXX....XX----STTS-HHHHHHHHHHHSSSSSS-TTS--TTT--HHHH---S--HHHHHHT--TT--.-----GGG--HH CS
        EIN3 106 paaiskyqaknlilsgesslqtersseshslselqDTtlgSLLsalmqhcdppqrrfplekgvepPWWPtGkelwwgelglskdqgtppykkphdlkka 204
                 paa+  y+ +  + +  ++ +    +++ +ls+l+DTtlgSLLs lmqhcdppqrr+pl+kgv+pPWWPtG e ww+elg+s+d g+ppykkphdlkka
  KHN02610.1  89 PAAMLRYDEESGLDDLLNEFS-GDPASPYRLSDLPDTTLGSLLSCLMQHCDPPQRRYPLDKGVAPPWWPTGLEIWWPELGFSEDPGPPPYKKPHDLKKA 186
                 *******77766655555553.36789************************************************************************ PP

                 HHHHHHHHHHHHTGGGHHHHHHTTTTSSSSTTT--SHHHHHHHHHHTTTTT-S--XXXX...XX.XXXX....XXXXXXXXXXXXXXXXXXXXXX.XXX CS
        EIN3 205 wkvsvLtavikhmsptieeirelerqskylqdkmsakesfallsvlnqeekecatvsah...ss.slrk....qspkvtlsceqkedvegkkeskikhv 295
                 wk+svLtavikh+sp++++i++ +r s+ lqdk +ake+ ++++v+++ee +++++++h   ++  +r+    +  +++l  +++     ++ + + +v
  KHN02610.1 187 WKLSVLTAVIKHISPDVTKINNIVRHSRTLQDKLTAKETSVWSAVMKREETLARRLHPHlfpPQpIIRRpneiHGARYFLGGQSS-----HNPPPTLNV 280
                 ***********************************************************97433423321112223333333222.....222332333 PP

                 XXXXXXX...................................................................................XXXXXXXXX CS
        EIN3 296 qavktta...................................................................................gfpvvrkrk 311
                  a+++++                                                                                   ++ +     
  KHN02610.1 281 AAHSNNNmllasgsarnflggqnnpppaynvsnggarnflggqnsptppsnvgngdgrsflgeqnnpppittnvvngisdnnsmvavnngNVVALGHGA 379
                 3333333566677778899999999999************************************************************99555555555 PP

                 XXXXXXXXXXXX......XXXXXXX.XXXXXXXXXXXXXXXX CS
        EIN3 312 kkpsesakvsskevsrtcqssqfrgsetelifadknsisqne 353
                 +k++e + + + +  + c+s q++++e++++f+d+n +++++
  KHN02610.1 380 NKRKEVQGITIPHDAYSCHSPQCPYHESSFGFSDRNVRNNHQ 421
                 566777777778889*************************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF048733.5E-1021236No hitNo description
Gene3DG3DSA:1.10.3180.105.6E-63114245IPR023278Ethylene insensitive 3-like protein, DNA-binding domain
SuperFamilySSF1167682.22E-53116239IPR023278Ethylene insensitive 3-like protein, DNA-binding domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 742 aa     Download sequence    Send to blast
MWRDRMLLRK LKDERKEREQ GKTVEMMKKK ALTRAQDIVL KNMLKMMEVC DVRGFVYGII  60
PEKGKPVSGA SDNLPGWWKE RVKFDRNGPA AMLRYDEESG LDDLLNEFSG DPASPYRLSD  120
LPDTTLGSLL SCLMQHCDPP QRRYPLDKGV APPWWPTGLE IWWPELGFSE DPGPPPYKKP  180
HDLKKAWKLS VLTAVIKHIS PDVTKINNIV RHSRTLQDKL TAKETSVWSA VMKREETLAR  240
RLHPHLFPPQ PIIRRPNEIH GARYFLGGQS SHNPPPTLNV AAHSNNNMLL ASGSARNFLG  300
GQNNPPPAYN VSNGGARNFL GGQNSPTPPS NVGNGDGRSF LGEQNNPPPI TTNVVNGISD  360
NNSMVAVNNG NVVALGHGAN KRKEVQGITI PHDAYSCHSP QCPYHESSFG FSDRNVRNNH  420
QLTCRYNNGN KDNNNTIQVV GGGGASSSSQ VGSGNPSNVN VPLGQSMNTA ATVVNPNQTQ  480
NLTNGQPMNI SAPVMTQNQS LTIGHPRHNA APTVSQNQTL TVISDNSGEK GSGGLMHNMN  540
VLQQKNSTSG AGSSSMSVVV PLGNQNLQQV QNVLQPQVVD NENFFGGGRV SLDKINFFGN  600
NNNNMNINVH PLLEASQNMQ QLQNAQPQVD KNFFGARVSV DKNNNLVGNT NIMNNIVPPL  660
GSQNMQQVQN VQPQVDKSTF VGERVDGGAS GYKLNNAEVH GDFSTSTSMD PSSYEWDANN  720
SQSDFMDSLL EAPSQDLFWL YN
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4zds_A7e-601132441132Protein ETHYLENE INSENSITIVE 3
4zds_B7e-601132441132Protein ETHYLENE INSENSITIVE 3
Search in ModeBase
Cis-element ? help Back to Top
SourceLink
PlantRegMapKHN02610.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAC1984460.0AC198446.7 Glycine max cultivar Williams 82 clone gmw2-129e12, complete sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_003523907.30.0ETHYLENE INSENSITIVE 3-like 1 protein
TrEMBLA0A445KZT40.0A0A445KZT4_GLYSO; ETHYLENE INSENSITIVE 3-like 1 protein
STRINGGLYMA06G47181.10.0(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF32234200
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G27050.11e-105ETHYLENE-INSENSITIVE3-like 1
Publications ? help Back to Top
  1. Qi X, et al.
    Identification of a novel salt tolerance gene in wild soybean by whole-genome sequencing.
    Nat Commun, 2014. 5: p. 4340
    [PMID:25004933]