PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID KHN01927.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Glycine; Soja
Family MYB_related
Protein Properties Length: 245aa    MW: 27506.3 Da    PI: 8.1235
Description MYB_related family protein
Gene Model
Gene Model ID Type Source Coding Sequence
KHN01927.1genomeTCUHKView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding38.91.9e-1264108347
                      SS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
  Myb_DNA-binding   3 rWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                      +WT+eE+  +  ++++lG+g+W+ I+r   + Rt+ q+ s+ qky
       KHN01927.1  64 PWTEEEHRTFPVGFEKLGKGDWRGISRNYVTSRTPTQVASHAQKY 108
                      8*******************************************9 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129415.48457113IPR017930Myb domain
SMARTSM007172.4E-861111IPR001005SANT/Myb domain
SuperFamilySSF466892.24E-1562113IPR009057Homeodomain-like
TIGRFAMsTIGR015573.9E-1563111IPR006447Myb domain, plants
Gene3DG3DSA:1.10.10.602.7E-963107IPR009057Homeodomain-like
CDDcd001671.96E-764109No hitNo description
PfamPF002496.6E-1064108IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 245 aa     Download sequence    Send to blast
MIRMEDSEGS GLCCWNGVFR FWYSFFSLCV FIELFKHANN GVFRSIQYIP KNSKWLQENL  60
TGVPWTEEEH RTFPVGFEKL GKGDWRGISR NYVTSRTPTQ VASHAQKYFI RLATMNKKKR  120
RSSLFDMVGN GITNPISSSN CKSSKCEIED DVTLSLVQLQ DTKLDEQKDS DKYCEAGPAG  180
AEHEAVPLWL HPQMKSSNNN VAAVVPDLEL TLAVSKGKAK TLLGLEQTQT KSSPDSFLLG  240
PISVT
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1116120KKKRR
Cis-element ? help Back to Top
SourceLink
PlantRegMapKHN01927.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankBT0977053e-95BT097705.1 Soybean clone JCVI-FLGm-16G4 unknown mRNA.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqNP_001235955.21e-130MYB transcription factor MYB128
TrEMBLA0A0B2P2L80.0A0A0B2P2L8_GLYSO; Transcription factor MYB1R1
STRINGGLYMA01G00600.11e-130(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF32133271
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G47390.14e-34MYB_related family protein
Publications ? help Back to Top
  1. Qi X, et al.
    Identification of a novel salt tolerance gene in wild soybean by whole-genome sequencing.
    Nat Commun, 2014. 5: p. 4340
    [PMID:25004933]