PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID KHN01787.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Glycine; Soja
Family LBD
Protein Properties Length: 196aa    MW: 22398.2 Da    PI: 6.7787
Description LBD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
KHN01787.1genomeTCUHKView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF260124.26.7e-398106199
      DUF260   1 aCaaCkvlrrkCakdCvlapyfpaeqpkkfanvhklFGasnvlkllkalpeeeredamsslvyeAearardPvyGavgvilklqqqleqlkaelallke 99 
                 aCaaCk++rrkC ++C+lapyfp++++k+f n+h+lFG+ ++++++k l++++r+ ams+l+ye+++rardP+ G+++++l+lq+q+  + +el+ll +
  KHN01787.1   8 ACAACKYQRRKCGSNCILAPYFPHDRQKQFLNAHRLFGVGKITNMIKPLDQHHRDLAMSTLIYESDMRARDPIGGCYSLVLQLQSQIFYATQELHLLLQ 106
                 7*******************************************************************************************9998765 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5089124.5097108IPR004883Lateral organ boundaries, LOB
PfamPF031956.3E-368103IPR004883Lateral organ boundaries, LOB
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0004088Molecular Functioncarbamoyl-phosphate synthase (glutamine-hydrolyzing) activity
Sequence ? help Back to Top
Protein Sequence    Length: 196 aa     Download sequence    Send to blast
MSRSSTQACA ACKYQRRKCG SNCILAPYFP HDRQKQFLNA HRLFGVGKIT NMIKPLDQHH  60
RDLAMSTLIY ESDMRARDPI GGCYSLVLQL QSQIFYATQE LHLLLQHLAY FKSHQPSSNP  120
SDIVNNVTPQ PPDPLEQTPQ EQQQQQQCFN YNLLQEDDIN MWAIQNSLSL LSPLSLENNI  180
NQDPVVDHGS HSLYST
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5ly0_A3e-24910112104LOB family transfactor Ramosa2.1
5ly0_B3e-24910112104LOB family transfactor Ramosa2.1
Search in ModeBase
Cis-element ? help Back to Top
SourceLink
PlantRegMapKHN01787.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_028246880.11e-145LOB domain-containing protein 22-like
SwissprotQ9LRW12e-43LBD22_ARATH; LOB domain-containing protein 22
TrEMBLA0A0B2P2981e-143A0A0B2P298_GLYSO; LOB domain-containing protein 22
STRINGGLYMA08G45176.11e-140(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF41333259
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G13850.13e-44LOB domain-containing protein 22
Publications ? help Back to Top
  1. Qi X, et al.
    Identification of a novel salt tolerance gene in wild soybean by whole-genome sequencing.
    Nat Commun, 2014. 5: p. 4340
    [PMID:25004933]
  2. Kim M,Kim MJ,Pandey S,Kim J
    Expression and Protein Interaction Analyses Reveal Combinatorial Interactions of LBD Transcription Factors During Arabidopsis Pollen Development.
    Plant Cell Physiol., 2016. 57(11): p. 2291-2299
    [PMID:27519310]