PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID KHN01327.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Glycine; Soja
Family M-type_MADS
Protein Properties Length: 353aa    MW: 39647.8 Da    PI: 6.8718
Description M-type_MADS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
KHN01327.1genomeTCUHKView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF35.51.3e-11948140
                S---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE CS
      SRF-TF  1 krienksnrqvtfskRrngilKKAeELSvLCdaevaviif 40
                k+i+n++ r+ tf  R++g++ K + LS++C++e+++i++
  KHN01327.1  9 KPISNERSRKSTFKTRKEGLITKISQLSTMCGVEACLIVY 48
                68*************************************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF554551.12E-15178IPR002100Transcription factor, MADS-box
SMARTSM004322.4E-9161IPR002100Transcription factor, MADS-box
PROSITE profilePS5006615.853150IPR002100Transcription factor, MADS-box
CDDcd002661.89E-19282No hitNo description
PfamPF003199.3E-131150IPR002100Transcription factor, MADS-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 353 aa     Download sequence    Send to blast
MGRARITLKP ISNERSRKST FKTRKEGLIT KISQLSTMCG VEACLIVYDD INGDVGAVTW  60
PENPTLVRPI IENYERQRAE KPPKTFVIQD FFENRKNMVE AEISKLHKQA REIKYPTWDP  120
SLSNMEKEQL SAFIANVNAK IEACDQRIHI KSMQNMAKES ASSSHSSQLN FMQNISQSQM  180
IPTYVEPLLN DNNNGRVLNS TNQVGGASSH GVNMLRNIQQ GNFCVSYMPS MAQSQMIALE  240
TFKSLKGKNK MVDFTNQVVV PLDSTNHQLG ESLDWANHHG SFDWANGPIG IEDWSNPLNG  300
DLVGSQPDES VLQNIPIQSQ NDYQGAVLPT LPLSLDGFQT DCRNMFFRMS NSK
Cis-element ? help Back to Top
SourceLink
PlantRegMapKHN01327.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_028240708.10.0agamous-like MADS-box protein AGL80
TrEMBLA0A0R0J4N40.0A0A0R0J4N4_SOYBN; Uncharacterized protein
STRINGGLYMA07G03401.11e-139(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF53431111
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G55690.16e-20M-type_MADS family protein
Publications ? help Back to Top
  1. Qi X, et al.
    Identification of a novel salt tolerance gene in wild soybean by whole-genome sequencing.
    Nat Commun, 2014. 5: p. 4340
    [PMID:25004933]