PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID KHN01193.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Glycine; Soja
Family HD-ZIP
Protein Properties Length: 283aa    MW: 32196 Da    PI: 6.5134
Description HD-ZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
KHN01193.1genomeTCUHKView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox573.3e-1878131356
                 --SS--HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHHH CS
    Homeobox   3 kRttftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRakek 56 
                 k+++++ eq+++Le+ Fe  +++  e++ +LA+ lgL+ rq+ +WFqNrRa++k
  KHN01193.1  78 KKRRLNMEQVKTLEKSFELGNKLEPERKMQLARALGLQPRQIAIWFQNRRARWK 131
                 456899***********************************************9 PP

2HD-ZIP_I/II131.72.9e-4277167191
  HD-ZIP_I/II   1 ekkrrlskeqvklLEesFeeeekLeperKvelareLglqprqvavWFqnrRARtktkqlEkdyeaLkraydalkeenerLekeveeLreel 91 
                  ekkrrl+ eqvk+LE+sFe  +kLeperK++lar+Lglqprq+a+WFqnrRAR+ktkqlEkdy++Lkr+y+a+k +n++L++++++L++e+
   KHN01193.1  77 EKKRRLNMEQVKTLEKSFELGNKLEPERKMQLARALGLQPRQIAIWFQNRRARWKTKQLEKDYDVLKRQYEAVKPDNDALQAQNQKLQAEI 167
                  69**************************************************************************************987 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF466891.28E-1968135IPR009057Homeodomain-like
PROSITE profilePS5007117.39473133IPR001356Homeobox domain
SMARTSM003891.8E-1876137IPR001356Homeobox domain
PfamPF000461.6E-1578131IPR001356Homeobox domain
CDDcd000865.07E-1678134No hitNo description
Gene3DG3DSA:1.10.10.601.8E-1980140IPR009057Homeodomain-like
PRINTSPR000311.1E-5104113IPR000047Helix-turn-helix motif
PROSITE patternPS000270108131IPR017970Homeobox, conserved site
PRINTSPR000311.1E-5113129IPR000047Helix-turn-helix motif
PfamPF021834.1E-16133173IPR003106Leucine zipper, homeobox-associated
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009744Biological Processresponse to sucrose
GO:0048826Biological Processcotyledon morphogenesis
GO:0080022Biological Processprimary root development
GO:0005634Cellular Componentnucleus
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 283 aa     Download sequence    Send to blast
MAFFPANFML QTPHHDDHHH QPPPSLTSIL PTCAPQEYHG GVTFLGKRSM SFSSGIEHGE  60
EVNAEEDLSD DGSQAGEKKR RLNMEQVKTL EKSFELGNKL EPERKMQLAR ALGLQPRQIA  120
IWFQNRRARW KTKQLEKDYD VLKRQYEAVK PDNDALQAQN QKLQAEILAL KSREPTESIN  180
LNKETEGSCS NRSENSSDIK LDISRTPAID SPHSTHQQSR PLFPPSSARP AGVAQLFQTS  240
SRPDLPSCQK IDQMVKEESL SNMFCGMDDQ SGFWPWLEQQ HFN
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1125133RRARWKTKQ
Functional Description ? help Back to Top
Source Description
UniProtProbable transcription factor that may act in the sucrose-signaling pathway. {ECO:0000269|PubMed:11292072}.
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00225DAPTransfer from AT1G69780Download
Motif logo
Cis-element ? help Back to Top
SourceLink
PlantRegMapKHN01193.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankBT0966950.0BT096695.1 Soybean clone JCVI-FLGm-21E13 unknown mRNA.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqNP_001241886.20.0homeobox-leucine zipper protein ATHB-13-like
RefseqXP_006572887.10.0uncharacterized protein LOC100814080 isoform X3
RefseqXP_028230631.10.0homeobox-leucine zipper protein ATHB-13-like isoform X1
RefseqXP_028230633.10.0homeobox-leucine zipper protein ATHB-13-like isoform X3
SwissprotQ8LC031e-122ATB13_ARATH; Homeobox-leucine zipper protein ATHB-13
TrEMBLA0A0R0LF960.0A0A0R0LF96_SOYBN; Uncharacterized protein
TrEMBLA0A445LYW40.0A0A445LYW4_GLYSO; Homeobox-leucine zipper protein ATHB-13 isoform A
TrEMBLI1J5M90.0I1J5M9_SOYBN; Uncharacterized protein
STRINGGLYMA01G05230.10.0(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF127133106
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G69780.11e-118HD-ZIP family protein
Publications ? help Back to Top
  1. Ding Y, et al.
    Four distinct types of dehydration stress memory genes in Arabidopsis thaliana.
    BMC Plant Biol., 2013. 13: p. 229
    [PMID:24377444]
  2. Qi X, et al.
    Identification of a novel salt tolerance gene in wild soybean by whole-genome sequencing.
    Nat Commun, 2014. 5: p. 4340
    [PMID:25004933]
  3. Ribone PA,Capella M,Chan RL
    Functional characterization of the homeodomain leucine zipper I transcription factor AtHB13 reveals a crucial role in Arabidopsis development.
    J. Exp. Bot., 2015. 66(19): p. 5929-43
    [PMID:26136262]
  4. Wang X, et al.
    Overexpressed BRH1, a RING finger gene, alters rosette leaf shape in Arabidopsis thaliana.
    Sci China Life Sci, 2018. 61(1): p. 79-87
    [PMID:28887625]
  5. Ebrahimian-Motlagh S, et al.
    JUNGBRUNNEN1 Confers Drought Tolerance Downstream of the HD-Zip I Transcription Factor AtHB13.
    Front Plant Sci, 2017. 8: p. 2118
    [PMID:29326734]