PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID KHN01099.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Glycine; Soja
Family G2-like
Protein Properties Length: 427aa    MW: 46800.8 Da    PI: 6.1179
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
KHN01099.1genomeTCUHKView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like87.71.1e-27176230156
     G2-like   1 kprlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRla 56 
                 k +++WtpeLH+rFv+aveqL G +kA+P++ile+m++++Lt+++++SHLQkYR++
  KHN01099.1 176 KVKVDWTPELHRRFVQAVEQL-GVDKAVPSRILEIMGIDCLTRHNIASHLQKYRSH 230
                 5689*****************.********************************86 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129418.042173232IPR017930Myb domain
SuperFamilySSF466892.33E-18174233IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.601.6E-26174233IPR009057Homeodomain-like
TIGRFAMsTIGR015571.4E-26176230IPR006447Myb domain, plants
PfamPF002491.3E-7179228IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 427 aa     Download sequence    Send to blast
MLAVSPLRSN IKDEKKQGEM EGNFSMATTT TTDDVVFGDL SEGNLLESIN FDELFVGIDI  60
HGDVLPDLEM FGEFSVDVST GEESSEMNSS AKSSKLENDQ NVIATTSKKE EEEDKTSCNA  120
SGQDLGSNRG EEIVSERDES VVVNPAPKDG GKGRKSSSAQ SKNNSSSNNN PQGKRKVKVD  180
WTPELHRRFV QAVEQLGVDK AVPSRILEIM GIDCLTRHNI ASHLQKYRSH RKHLLAREAE  240
AASWSQRRQL CAGGGKREGS PWLAPTMGFP PMTPPMHHFR PLHVWGHPSM DQSFMHMWPK  300
HLPNSPPLSW PPPAAPPQEP SFWHQLVPNA LIPGTACFPQ LLTPTRFGSP PVPGIPPHAM  360
YKADHDIGLP GPLFDFYPSK ECIDAAIGDV LSKPWLPLPI GLKAPALDSV MSELQRQGIP  420
NIPPSSA
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1irz_A6e-16173228257ARR10-B
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankBT0955030.0BT095503.1 Soybean clone JCVI-FLGm-19O16 unknown mRNA.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqNP_001241943.10.0uncharacterized protein LOC100799248
SwissprotQ9SIV33e-99GLK1_ARATH; Transcription activator GLK1
TrEMBLA0A0B2P0Q20.0A0A0B2P0Q2_GLYSO; Transcription activator GLK1
STRINGGLYMA06G44330.10.0(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF42423461
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G20570.12e-75GBF's pro-rich region-interacting factor 1
Publications ? help Back to Top
  1. Qi X, et al.
    Identification of a novel salt tolerance gene in wild soybean by whole-genome sequencing.
    Nat Commun, 2014. 5: p. 4340
    [PMID:25004933]