PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID KHN00963.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Glycine; Soja
Family G2-like
Protein Properties Length: 393aa    MW: 43213.4 Da    PI: 8.8387
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
KHN00963.1genomeTCUHKView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like106.71.3e-33124178155
     G2-like   1 kprlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRl 55 
                 kprlrWt +LHerFv+av+qLGG+ kAtPk+i+++m+vkgLtl+h+kSHLQkYRl
  KHN00963.1 124 KPRLRWTADLHERFVDAVTQLGGASKATPKAIMRTMNVKGLTLYHLKSHLQKYRL 178
                 79****************************************************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.601.7E-32121179IPR009057Homeodomain-like
PROSITE profilePS5129410.726121181IPR017930Myb domain
TIGRFAMsTIGR015571.3E-23124179IPR006447Myb domain, plants
SuperFamilySSF466891.58E-16124180IPR009057Homeodomain-like
PfamPF002491.1E-7126177IPR001005SANT/Myb domain
PfamPF143796.4E-13220265IPR025756MYB-CC type transcription factor, LHEQLE-containing domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 393 aa     Download sequence    Send to blast
MIGGKQRAAN AKKEEKKGKA AESDKIPVKS DSASSLKPKS CAFHIPIFPF PFLLPLSPNG  60
SPITQSSPFF FPLSFFFASR WGFKFHHRMF SRLIHPHEGQ EDMQGGSNHA HLGDPCLVLT  120
SDPKPRLRWT ADLHERFVDA VTQLGGASKA TPKAIMRTMN VKGLTLYHLK SHLQKYRLGK  180
QSGKDSDEGC KDGMSASYLQ ESPGTDNSSP KLPDANEGHE VKEALRAQME VQSKLHLLVE  240
AEKHLQIRQD AERRYMGMLE RACKMLADQF IGDVTIDMDG QKFQGLESKT SRSSLVDHVG  300
FYPQACTEVG GMHASVVSPI LQPQGADCFT ESCLTSLESL GGLTLEGSPG GSKKRMLNLD  360
SMVAPLIWSE ANTRTQGIHL AKVNPSGMTR YGM
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankBT0932100.0BT093210.1 Soybean clone JCVI-FLGm-14A7 unknown mRNA.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006605380.10.0PREDICTED: uncharacterized protein LOC100811831 isoform X1
TrEMBLA0A0B2P0950.0A0A0B2P095_GLYSO; Myb family transcription factor APL
TrEMBLK7N4H40.0K7N4H4_SOYBN; Uncharacterized protein
STRINGGLYMA20G33540.20.0(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF66183349
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G24120.18e-63G2-like family protein
Publications ? help Back to Top
  1. Qi X, et al.
    Identification of a novel salt tolerance gene in wild soybean by whole-genome sequencing.
    Nat Commun, 2014. 5: p. 4340
    [PMID:25004933]