PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID KHN00905.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Glycine; Soja
Family G2-like
Protein Properties Length: 381aa    MW: 42183 Da    PI: 7.0311
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
KHN00905.1genomeTCUHKView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like100.51.1e-31209263256
     G2-like   2 prlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRla 56 
                  r++W+++LH+rF++a++qLGG++ AtPk+i+elm+v+gLt+++vkSHLQkYRl+
  KHN00905.1 209 LRRCWSQDLHKRFLHALQQLGGADSATPKQIRELMNVDGLTNDEVKSHLQKYRLH 263
                 69***************************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129412.238205265IPR017930Myb domain
SuperFamilySSF466892.96E-17206266IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.601.3E-28206266IPR009057Homeodomain-like
TIGRFAMsTIGR015571.2E-26208263IPR006447Myb domain, plants
PfamPF002492.4E-7210261IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 381 aa     Download sequence    Send to blast
MYFFTEKMQS LKMGFPDYIQ TLEEERRKIQ VFSKELPLSL ELVTQAIETC KQQLSGTTSE  60
YNLNGHSECS EQTTSTEGPV LEEFIPIKKR ASSSSPCCDE DDEQHSHKQR VSKENNNSDK  120
RKSDWLRSVQ LWNPDPPAEE DVSKIVCGVE LKRSGSGGGA FQPLHKEEKS SKPSESLSKT  180
PSSTPVVATS SSAVEPAEEK SLNEGQRKLR RCWSQDLHKR FLHALQQLGG ADSATPKQIR  240
ELMNVDGLTN DEVKSHLQKY RLHTRRPIPM VHNSSDPQTA PFVLVGNIFV QSPEYAAVAT  300
STASREVATV AAPARIYAPV ATHPTPVSHP PDDSIKKPQF KKVKLFELSN SDDRANHSEG  360
AVHSNSPTSS SSTHTSTSPG Y
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00160DAPTransfer from AT1G25550Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankKT0311960.0KT031196.1 Glycine max clone HN_CCL_161 MYB/HD-like transcription factor (Glyma10g34780.1) mRNA, partial cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_003556266.10.0PREDICTED: uncharacterized protein LOC100789537
TrEMBLA0A0B2NV350.0A0A0B2NV35_GLYSO; Two-component response regulator ARR18
STRINGGLYMA20G32770.10.0(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF39183363
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G25550.13e-78G2-like family protein
Publications ? help Back to Top
  1. Qi X, et al.
    Identification of a novel salt tolerance gene in wild soybean by whole-genome sequencing.
    Nat Commun, 2014. 5: p. 4340
    [PMID:25004933]