PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID KHN00821.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Glycine; Soja
Family LBD
Protein Properties Length: 222aa    MW: 24062.7 Da    PI: 6.8671
Description LBD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
KHN00821.1genomeTCUHKView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF260135.91.5e-42691681100
      DUF260   1 aCaaCkvlrrkCakdCvlapyfpaeqpkkfanvhklFGasnvlkllkalpeeeredamsslvyeAearardPvyGavgvilklqqqleqlkaelallke 99 
                 +CaaCk+lrr+C+++Cvlapyfp ++p kf ++h++FGasn++k+l++lpe++r da+ss+vyeA+ar+rdPvyG++g i +lq+q+++l+a+la++++
  KHN00821.1  69 PCAACKILRRRCVEKCVLAPYFPPTDPLKFTIAHRVFGASNIIKFLQELPESQRADAVSSMVYEANARIRDPVYGCAGAICQLQKQVSELQAQLAKAQA 167
                 7**********************************************************************************************9997 PP

      DUF260 100 e 100
                 e
  KHN00821.1 168 E 168
                 6 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5089125.96468169IPR004883Lateral organ boundaries, LOB
PfamPF031958.8E-4369166IPR004883Lateral organ boundaries, LOB
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0004088Molecular Functioncarbamoyl-phosphate synthase (glutamine-hydrolyzing) activity
Sequence ? help Back to Top
Protein Sequence    Length: 222 aa     Download sequence    Send to blast
MEYKVKTTTS TPSPPIPIHL PTMLSNSPPS SSSSPPSQSP TPFPSPSQGS PSAAPPSPPP  60
PPPPVVVSPC AACKILRRRC VEKCVLAPYF PPTDPLKFTI AHRVFGASNI IKFLQELPES  120
QRADAVSSMV YEANARIRDP VYGCAGAICQ LQKQVSELQA QLAKAQAEVV NMQCQQANLV  180
ALICMEMSQS QEQHVLQPQP HVDMSCFIED NSFGTAWEPL WT
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5ly0_A9e-43611763118LOB family transfactor Ramosa2.1
5ly0_B9e-43611763118LOB family transfactor Ramosa2.1
Search in ModeBase
Cis-element ? help Back to Top
SourceLink
PlantRegMapKHN00821.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankBT0991130.0BT099113.1 Soybean clone JCVI-FLGm-13B15 unknown mRNA.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_003556215.11e-160LOB domain-containing protein 1
RefseqXP_028220889.11e-160LOB domain-containing protein 1-like
SwissprotQ9LQR02e-77LBD1_ARATH; LOB domain-containing protein 1
TrEMBLA0A445F6K81e-158A0A445F6K8_GLYSO; LOB domain-containing protein 1
TrEMBLI1NHD11e-158I1NHD1_SOYBN; Uncharacterized protein
STRINGGLYMA20G31780.11e-159(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF130334106
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G07900.12e-67LOB domain-containing protein 1
Publications ? help Back to Top
  1. Qi X, et al.
    Identification of a novel salt tolerance gene in wild soybean by whole-genome sequencing.
    Nat Commun, 2014. 5: p. 4340
    [PMID:25004933]