PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID KHN00812.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Glycine; Soja
Family GRAS
Protein Properties Length: 402aa    MW: 45725 Da    PI: 6.4353
Description GRAS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
KHN00812.1genomeTCUHKView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GRAS306.75.5e-94214001374
        GRAS   1 lvelLlecAeavssgdlelaqalLarlselaspdgdpmqRlaayfteALaarlarsvselykalppsetseknsseelaalklfsevsPilkfshltaN 99 
                 l++lLl+ A+av+++++    + La l +++s +gd++qR++ayf+ +L+arl+   s  y+ l  ++t+    +ee+ +++ ++ vsP+++f+h+taN
  KHN00812.1  21 LIHLLLSTATAVDDNNMDSSLENLADLYQTVSITGDSVQRVVAYFVDGLSARLLTRKSPFYDMLMEEPTT----EEEFLSFTDLYRVSPYFQFAHFTAN 115
                 689****************************************************9*****999998887....5667777889*************** PP

        GRAS 100 qaIleavege.....ervHiiDfdisqGlQWpaLlqaLasRp..egppslRiTgvgspesgskeeleetgerLakfAeelg.vpfefnvlvakrledle 190
                 qaIlea+e+e     +++H+iDfd+s+G+QWp+L+q+L++++  ++  slRiTg+g+    + +el+et++rL +f + +g + fef+ l    l   +
  KHN00812.1 116 QAILEAFEKEeernnRALHVIDFDVSYGFQWPSLIQSLSEKAtsGNRISLRITGFGK----NLKELQETESRLVNFSKGFGsLVFEFQGL----LRGSR 206
                 ********9988877789**********************99755566*********....99****************97689*****8....77778 PP

        GRAS 191 leeLrvkpgEalaVnlvlqlhrlldesvsleserdevLklvkslsPkvvvvveqeadhnsesFlerflealeyysalfdsleaklpreseerikvErel 289
                 + +Lr k++E++aVnlv  l +l     +  + ++++L +v sl+P +vvvveqe +++  sFl rf+++l+y++a+fdsl+  lp es er  +E++l
  KHN00812.1 207 VINLRKKKNETVAVNLVSYLNTLS----CFMK-ISDTLGFVHSLNPSIVVVVEQEGSRSPRSFLSRFTDSLHYFAAMFDSLDDCLPLESAERLRIEKKL 300
                 899***************999997....3333.578*************************************************************** PP

        GRAS 290 lgreivnvvacegae..rrerhetlekWrerleeaGFkpvplsekaakqaklllrkv........ksdg...yrveee.sgslv.lgWkdrpLvsvSaW 373
                 lg+ei++++ +  +      + e++e+W++r+e+ GF + ++s+k + qaklll++         +++g   +rv e+ +g ++ lgW++r L++vSaW
  KHN00812.1 301 LGKEIKSMLNNDVDGgvDCPKYERMETWKARMENHGFVATKISSKSMIQAKLLLKMRthycplqfEEEGgggFRVSERdEGRAIsLGWQNRFLLTVSAW 399
                 *********9986663356799********************************9852222221122223348887664555557************** PP

        GRAS 374 r 374
                 +
  KHN00812.1 400 Q 400
                 6 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5098548.0731367IPR005202Transcription factor GRAS
PfamPF035141.9E-9121400IPR005202Transcription factor GRAS
Sequence ? help Back to Top
Protein Sequence    Length: 402 aa     Download sequence    Send to blast
MLRQDHHRRK GVVEDGNGLP LIHLLLSTAT AVDDNNMDSS LENLADLYQT VSITGDSVQR  60
VVAYFVDGLS ARLLTRKSPF YDMLMEEPTT EEEFLSFTDL YRVSPYFQFA HFTANQAILE  120
AFEKEEERNN RALHVIDFDV SYGFQWPSLI QSLSEKATSG NRISLRITGF GKNLKELQET  180
ESRLVNFSKG FGSLVFEFQG LLRGSRVINL RKKKNETVAV NLVSYLNTLS CFMKISDTLG  240
FVHSLNPSIV VVVEQEGSRS PRSFLSRFTD SLHYFAAMFD SLDDCLPLES AERLRIEKKL  300
LGKEIKSMLN NDVDGGVDCP KYERMETWKA RMENHGFVAT KISSKSMIQA KLLLKMRTHY  360
CPLQFEEEGG GGFRVSERDE GRAISLGWQN RFLLTVSAWQ SV
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5hyz_A3e-41204003375GRAS family transcription factor containing p
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAP0150410.0AP015041.1 Vigna angularis var. angularis DNA, chromosome 8, almost complete sequence, cultivar: Shumari.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_003555429.10.0PREDICTED: scarecrow-like protein 21
TrEMBLA0A0R0EMS00.0A0A0R0EMS0_SOYBN; Uncharacterized protein
STRINGGLYMA20G31680.20.0(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF62002952
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G54220.11e-56GRAS family protein