PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID KHN00475.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Glycine; Soja
Family MYB_related
Protein Properties Length: 782aa    MW: 87050.9 Da    PI: 6.5651
Description MYB_related family protein
Gene Model
Gene Model ID Type Source Coding Sequence
KHN00475.1genomeTCUHKView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding24.66.1e-085496347
                     SS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
  Myb_DNA-binding  3 rWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47
                     +WT +E+e +  a +q G++ +++I ++++  +   q++++++ +
       KHN00475.1 54 AWTRQEEESFFTALRQVGKN-FEKITSRVQ-SKNKDQVRHYYYRL 96
                     6*****************99.*********.***********976 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF466891.42E-1046101IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.601.8E-54899IPR009057Homeodomain-like
PROSITE profilePS5129313.41650101IPR017884SANT domain
SMARTSM007172.7E-65199IPR001005SANT/Myb domain
CDDcd001677.13E-65497No hitNo description
PfamPF002495.4E-65496IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0016310Biological Processphosphorylation
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0016301Molecular Functionkinase activity
Sequence ? help Back to Top
Protein Sequence    Length: 782 aa     Download sequence    Send to blast
MEVEVPISLD SNNQLQPETV VSVQIGDPGV SLSVANAVNP QQQATKKPTR QWAAWTRQEE  60
ESFFTALRQV GKNFEKITSR VQSKNKDQVR HYYYRLVRRM NKLLGPGLCL DAKNSKDTNA  120
AMLRWWSLLE KYSCKASKLH LKPRRFKIFL EALEHQLLKD RKKNVRKRPL QGGNCLPSAP  180
TTVSNQSRAS GNDAYAVKLV LVDSQNILKL GPSKPSTKRN VNMGVNRSNT KGDSNTMKPT  240
RQRKKSGTIS TAAYRKWEKA AIAGVSLVAD AAEHLERAAT VKGIEQDQEN PGEKCSDPAD  300
YVLPSLPTCP QNQFVDNNVN NIMKLKLQLF PIDEPTRRAL EMDKHNPHLE LTLSTRKKIS  360
SILEHLNRKW GNSSIAAGEV MLFPYGIQRE NLVNCPRWTQ ESTLSAADIY AMIGSPPIFR  420
LRYGWFSNTE LGLLNMQVPV ASGSMLRQYK STVDNAKDQI VNSVSFPTPL TNTHSMELSE  480
DCRTSMNRNR TLITASTEES RDPTANTLWH GKDVRDGAVS TQLEDMDELK ISSGAGLSAG  540
EWADSLTNIS VGDLLSGVSQ DLDNCIDPPI AENFHDIQQI PFSSDSFDAA IAAHISRHQD  600
RMGQSSLASH MSSIWDAEET CDAFLFKKDP ILHEDHPRLS PVASLESEKK VTKRSFDKLD  660
ELSPERERLV DDCAQTDPNP MDSSESDADI QEHLGKDFSA LADMYWPDSL GPLDLDISSS  720
TKYHSEDLIF SDSLSGLNRL IASSLDAFQN CSFFGFDKKE APSTVEARES AALSDFKIGS  780
GI
Cis-element ? help Back to Top
SourceLink
PlantRegMapKHN00475.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAC2358910.0AC235891.2 Glycine max clone GM_WBc0069F21, complete sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_003519867.10.0TSL-kinase interacting protein 1
RefseqXP_028196599.10.0TSL-kinase interacting protein 1-like
SwissprotQ8LJT80.0TKI1_ARATH; TSL-kinase interacting protein 1
TrEMBLA0A445LJM10.0A0A445LJM1_GLYSO; TSL-kinase interacting protein 1
TrEMBLK7K6H40.0K7K6H4_SOYBN; Uncharacterized protein
STRINGGLYMA02G05420.20.0(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF98832531
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G36960.20.0TSL-kinase interacting protein 1
Publications ? help Back to Top
  1. Qi X, et al.
    Identification of a novel salt tolerance gene in wild soybean by whole-genome sequencing.
    Nat Commun, 2014. 5: p. 4340
    [PMID:25004933]