PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID KHM99844.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Glycine; Soja
Family MYB_related
Protein Properties Length: 266aa    MW: 29349.9 Da    PI: 9.4871
Description MYB_related family protein
Gene Model
Gene Model ID Type Source Coding Sequence
KHM99844.1genomeTCUHKView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding452.4e-1495139347
                      SS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
  Myb_DNA-binding   3 rWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                      +WT+eE+ +++ + ++lG+g+W+ I+r + ++Rt+ q+ s+ qky
       KHM99844.1  95 PWTEEEHRIFLVGLEKLGKGDWRGISRNFVTTRTPTQVASHAQKY 139
                      8*******************************************9 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:4.10.60.104.4E-4320IPR001878Zinc finger, CCHC-type
PROSITE profilePS5129418.52788144IPR017930Myb domain
SuperFamilySSF466899.72E-1889144IPR009057Homeodomain-like
TIGRFAMsTIGR015576.2E-1891142IPR006447Myb domain, plants
SMARTSM007173.5E-1192142IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.601.2E-1192138IPR009057Homeodomain-like
CDDcd001676.54E-1095140No hitNo description
PfamPF002499.6E-1295139IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0008270Molecular Functionzinc ion binding
Sequence ? help Back to Top
Protein Sequence    Length: 266 aa     Download sequence    Send to blast
MGRKCSHCGT IGHNSRTCTS LRGTSFVGLR LFGVQLDTTC VTIKKSFSMD SLPSSSSSSF  60
SSSRITIDEN SDRTSFGYLS DGLLARAQER KKGVPWTEEE HRIFLVGLEK LGKGDWRGIS  120
RNFVTTRTPT QVASHAQKYF LRLATMDKKK RRSSLFDLVG SNKAGSNSVS AHQNDESKCE  180
VKNNNDDATL SLLGRITYFQ QETKSSDYKQ ETFDNCSNQS QPSEEHQPAV LNLDLTLAAP  240
KAKTLQEQNK PSPSAPFLPG PIISVT
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1147151KKKRR
Functional Description ? help Back to Top
Source Description
UniProtTranscription repressor that binds to 5'-TATCCA-3' elements in gene promoters. Contributes to the sugar-repressed transcription of promoters containing SRS or 5'-TATCCA-3' elements. Transcription repressor involved in a cold stress response pathway that confers cold tolerance. Suppresses the DREB1-dependent signaling pathway under prolonged cold stress. DREB1 responds quickly and transiently while MYBS3 responds slowly to cold stress. They may act sequentially and complementarily for adaptation to short- and long-term cold stress (PubMed:20130099). {ECO:0000269|PubMed:12172034, ECO:0000269|PubMed:20130099}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapKHM99844.1
Regulation -- Description ? help Back to Top
Source Description
UniProtINDUCTION: Repressed by sucrose and gibberellic acid (GA) (PubMed:12172034). Induced by cold stress in roots and shoots. Induced by salt stress in shoots. Down-regulated by abscisic aci (ABA) in shoots (PubMed:20130099). {ECO:0000269|PubMed:12172034, ECO:0000269|PubMed:20130099}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankKT0311940.0KT031194.1 Glycine max clone HN_CCL_90 MYB/HD-like transcription factor (Glyma08g03330.1) mRNA, partial cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_003525309.10.0transcription factor MYBS3
RefseqXP_028233765.10.0transcription factor MYBS3-like
SwissprotQ7XC574e-50MYBS3_ORYSJ; Transcription factor MYBS3
TrEMBLA0A445KSQ70.0A0A445KSQ7_GLYSO; Transcription factor MYBS3
TrEMBLI1K6380.0I1K638_SOYBN; Uncharacterized protein
STRINGGLYMA05G36290.10.0(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF32133271
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G56840.15e-56MYB_related family protein
Publications ? help Back to Top
  1. Rice Chromosome 10 Sequencing Consortium
    In-depth view of structure, activity, and evolution of rice chromosome 10.
    Science, 2003. 300(5625): p. 1566-9
    [PMID:12791992]
  2. Kikuchi S, et al.
    Collection, mapping, and annotation of over 28,000 cDNA clones from japonica rice.
    Science, 2003. 301(5631): p. 376-9
    [PMID:12869764]
  3. Su CF, et al.
    A novel MYBS3-dependent pathway confers cold tolerance in rice.
    Plant Physiol., 2010. 153(1): p. 145-58
    [PMID:20130099]
  4. Qi X, et al.
    Identification of a novel salt tolerance gene in wild soybean by whole-genome sequencing.
    Nat Commun, 2014. 5: p. 4340
    [PMID:25004933]