PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID KHM99706.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Glycine; Soja
Family MYB_related
Protein Properties Length: 178aa    MW: 20103.8 Da    PI: 8.5092
Description MYB_related family protein
Gene Model
Gene Model ID Type Source Coding Sequence
KHM99706.1genomeTCUHKView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding56.56.5e-181054147
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47
                     rg+++ eEd+l+++++ +lG++ W++Ia +++ gRt++++k++w+++
       KHM99706.1 10 RGNFSLEEDQLIIKLHSLLGNK-WSLIAGRLP-GRTDNEIKNYWNTH 54
                     89********************.*********.************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.601.0E-26259IPR009057Homeodomain-like
SuperFamilySSF466891.36E-16261IPR009057Homeodomain-like
PROSITE profilePS5129427.781559IPR017930Myb domain
SMARTSM007171.5E-16957IPR001005SANT/Myb domain
PfamPF002492.7E-161054IPR001005SANT/Myb domain
CDDcd001672.29E-131255No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 178 aa     Download sequence    Send to blast
INYLRPDLKR GNFSLEEDQL IIKLHSLLGN KWSLIAGRLP GRTDNEIKNY WNTHIRRKLL  60
SRGIDPATHR PLNDSSHQEP AAVSAPPKQQ ESFHHERCPD LNLELTISPP HHPQPDHPHL  120
KTLVTNSNLC FPCSLGLHNS KDCSCALHTS TANATATGYD FLALKTTVVL DYRTLHMK
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A1e-1525951108B-MYB
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtTranscription factor. {ECO:0000305}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapKHM99706.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankFJ5550571e-101FJ555057.1 Glycine max transcription factor MYB047 mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqNP_001235637.11e-128MYB transcription factor MYB48
RefseqXP_028234492.11e-128myb-related protein 308-like
SwissprotP813931e-62MYB08_ANTMA; Myb-related protein 308
TrEMBLA0A0B2NW491e-129A0A0B2NW49_GLYSO; Myb-related protein 308 (Fragment)
STRINGGLYMA06G00630.11e-127(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF26434221
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G38620.15e-57myb domain protein 4
Publications ? help Back to Top
  1. Jackson D,Culianez-Macia F,Prescott AG,Roberts K,Martin C
    Expression patterns of myb genes from Antirrhinum flowers.
    Plant Cell, 1991. 3(2): p. 115-25
    [PMID:1840903]
  2. Qi X, et al.
    Identification of a novel salt tolerance gene in wild soybean by whole-genome sequencing.
    Nat Commun, 2014. 5: p. 4340
    [PMID:25004933]