PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID KHM99331.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Glycine; Soja
Family MYB_related
Protein Properties Length: 307aa    MW: 35120.9 Da    PI: 10.2795
Description MYB_related family protein
Gene Model
Gene Model ID Type Source Coding Sequence
KHM99331.1genomeTCUHKView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding42.81.2e-133983147
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47
                     r +WT +E++++++a +++  + Wk+I + +g  +t  q++s+ qky
       KHM99331.1 39 RENWTDQEHDKFLEALHLFDRD-WKKIEAFVG-SKTVIQIRSHAQKY 83
                     789*****************77.*********.*************9 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF466892.09E-163389IPR009057Homeodomain-like
PROSITE profilePS5129414.7973488IPR017930Myb domain
TIGRFAMsTIGR015573.4E-173786IPR006447Myb domain, plants
Gene3DG3DSA:1.10.10.602.0E-63789IPR009057Homeodomain-like
SMARTSM007175.6E-113886IPR001005SANT/Myb domain
PfamPF002493.3E-113983IPR001005SANT/Myb domain
CDDcd001672.11E-84184No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 307 aa     Download sequence    Send to blast
MVSLNLNPNP PQTFHFFDPF NMEDQNKKVR KPYTITKSRE NWTDQEHDKF LEALHLFDRD  60
WKKIEAFVGS KTVIQIRSHA QKYFMKVQKN GTSEHVPPPR PKRKAAHPYP QKASKNALTI  120
SQVARPLQSS SALSESSHIY RPDSSSVVRT PVSSVPLPSW VYNVTPPVSL PRVTKDDMVL  180
MSQQINPFSS SNESTPRGWP ISKQTDQGDQ GKPTIVMPDF AQVYSFIGTV FDPNAINHLQ  240
RLKQMDPINV KTILLLMRNL STNLRSPEFE NERRMLSLYY ANMEKEKSSS HRSQPLTDRS  300
ESVVLSA
Functional Description ? help Back to Top
Source Description
UniProtProbable transcription factor. {ECO:0000250}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapKHM99331.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAP0150378e-53AP015037.1 Vigna angularis var. angularis DNA, chromosome 4, almost complete sequence, cultivar: Shumari.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_028212645.10.0protein REVEILLE 6-like
SwissprotQ8H0W32e-95RVE6_ARATH; Protein REVEILLE 6
TrEMBLA0A0B2NV400.0A0A0B2NV40_GLYSO; Protein REVEILLE 6 isoform A
STRINGGLYMA18G47230.10.0(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF11193396
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G01280.12e-76MYB_related family protein
Publications ? help Back to Top
  1. Ding Y, et al.
    Four distinct types of dehydration stress memory genes in Arabidopsis thaliana.
    BMC Plant Biol., 2013. 13: p. 229
    [PMID:24377444]
  2. Qi X, et al.
    Identification of a novel salt tolerance gene in wild soybean by whole-genome sequencing.
    Nat Commun, 2014. 5: p. 4340
    [PMID:25004933]
  3. Gray JA,Shalit-Kaneh A,Chu DN,Hsu PY,Harmer SL
    The REVEILLE Clock Genes Inhibit Growth of Juvenile and Adult Plants by Control of Cell Size.
    Plant Physiol., 2017. 173(4): p. 2308-2322
    [PMID:28254761]