PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID KHM98998.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Glycine; Soja
Family G2-like
Protein Properties Length: 368aa    MW: 41305.6 Da    PI: 7.6738
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
KHM98998.1genomeTCUHKView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like97.59.5e-31244299156
     G2-like   1 kprlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRla 56 
                 k+r++W+peLH+rF++a+e LGGs+ AtPk+i+elm v+gLt+++vkSHLQkYRl+
  KHM98998.1 244 KQRRCWSPELHSRFIKALEVLGGSQAATPKQIRELMRVDGLTNDEVKSHLQKYRLH 299
                 79****************************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.606.0E-28241302IPR009057Homeodomain-like
PROSITE profilePS5129413.853241301IPR017930Myb domain
SuperFamilySSF466896.72E-17242302IPR009057Homeodomain-like
TIGRFAMsTIGR015573.4E-25244299IPR006447Myb domain, plants
PfamPF002497.6E-7246297IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 368 aa     Download sequence    Send to blast
MGLVVPEEEL SLDLRPSFVP KTITDFLCHL STTPNASHKV SLLDDFVHRL ELELAKIQAF  60
KRELPLCMFL LNDAISALKV ESEKCRACKS EPVFEEFIPL KKECDQRKEI EKEKECRDKK  120
NWMSSFQLWN NDDKADNNNN AYECDKKHNY RVENKNNGEK RKSVTKDLFQ YGRIRNGEKG  180
FVIPFSSYPA TKEEKEDCVA NGLSLQTPGT AVKSTREGSG CRTSSCRVGS SAPSPLHQPQ  240
SSRKQRRCWS PELHSRFIKA LEVLGGSQAA TPKQIRELMR VDGLTNDEVK SHLQKYRLHT  300
QRVPVATAAN FSRSAVDLGG LWMHNESLKG GSSGSPQGPL QLATQSGEAT SQTEGDNMID  360
DDDVKSDL
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_003555716.10.0PREDICTED: uncharacterized protein LOC100809323 isoform X1
TrEMBLA0A0B2NUN90.0A0A0B2NUN9_GLYSO; Two-component response regulator ARR10
TrEMBLI1ND350.0I1ND35_SOYBN; Uncharacterized protein
STRINGGLYMA20G01260.10.0(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF120834107
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G03500.11e-53G2-like family protein
Publications ? help Back to Top
  1. Qi X, et al.
    Identification of a novel salt tolerance gene in wild soybean by whole-genome sequencing.
    Nat Commun, 2014. 5: p. 4340
    [PMID:25004933]