PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID KHM98866.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Glycine; Soja
Family LBD
Protein Properties Length: 198aa    MW: 22554.7 Da    PI: 4.435
Description LBD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
KHM98866.1genomeTCUHKView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF26077.13.1e-2410106198
      DUF260   1 aCaaCkvlrrkCakdCvlapyfpaeqpkkfanvhklFGasnvlkllkalpeeeredamsslvyeAearardPvyGavgvilklqqqleqlkaelallk 98 
                 +C  C+ +rr+  ++C + +yf  + + +f+ + +lFG +n+++l+++++++er+++++s+++eA+++ rdP++Ga+g++++l +q+++ ++el++++
  KHM98866.1  10 SCPICRNQRRRHDDNCEFGQYFLGR-STDFESACRLFGFANLVRLMRSVEPSERQATADSILMEANIWDRDPINGAYGHVFNLVSQIQSFESELETIN 106
                 699******************9765.589****************************************************************99876 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5089118.569109IPR004883Lateral organ boundaries, LOB
PfamPF031951.7E-2410106IPR004883Lateral organ boundaries, LOB
Sequence ? help Back to Top
Protein Sequence    Length: 198 aa     Download sequence    Send to blast
MSQGNRNYFS CPICRNQRRR HDDNCEFGQY FLGRSTDFES ACRLFGFANL VRLMRSVEPS  60
ERQATADSIL MEANIWDRDP INGAYGHVFN LVSQIQSFES ELETINNWLA HIRDQQRQPS  120
SFSPNIPNQS IQDEGSNTPI PSLIGADIST RSSEKGESSI VAPKEDANIV VRERDSKVDD  180
NEEGTIPDKE QVDYFRDD
Cis-element ? help Back to Top
SourceLink
PlantRegMapKHM98866.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006585733.11e-146LOB domain-containing protein 5
RefseqXP_028246683.11e-146LOB domain-containing protein 5-like
TrEMBLA0A0R0IRH11e-144A0A0R0IRH1_SOYBN; Uncharacterized protein
TrEMBLA0A445JJ361e-144A0A445JJ36_GLYSO; LOB domain-containing protein 28
STRINGGLYMA08G25501.11e-144(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF1630089
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G50510.12e-19LOB domain-containing protein 28
Publications ? help Back to Top
  1. Qi X, et al.
    Identification of a novel salt tolerance gene in wild soybean by whole-genome sequencing.
    Nat Commun, 2014. 5: p. 4340
    [PMID:25004933]