PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID KHM98847.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Glycine; Soja
Family GRAS
Protein Properties Length: 484aa    MW: 55141.2 Da    PI: 4.9381
Description GRAS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
KHM98847.1genomeTCUHKView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GRAS84.41.9e-2615627045157
        GRAS  45 fteALaarlarsvselykalppsetsekn.....sseelaalklfsevsPilkfshltaNqaIleavegeervHiiDfdisqGlQWpaLlqaLasRpeg 138
                 f+++L+ rl+   +++ +  + ++ s ++      ++++ a++l+++++P++ f+++ aN+ I++a +g++ +Hi+D+++++ lQW +L++aLasRpeg
  KHM98847.1 156 FAKGLKCRLSLLPHNVIANGTLTSIS-MDvplisRENKMEAFQLLYQTTPYISFGFMGANEVIYQASQGKSSMHIVDLGMENTLQWSSLIRALASRPEG 253
                 66666666666333333333332222.223555567788999********************************************************* PP

        GRAS 139 ppslRiTgvgspesgskee 157
                  p+lRiTg+  +e +   +
  KHM98847.1 254 HPTLRITGLTGNEDN--SN 270
                 *********985533..33 PP

2GRAS163.32.1e-50279434212372
        GRAS 212 rlldesvsleserdevLklvkslsPkvvvvveqeadhnsesFlerflealeyysalfdsleaklpreseerikvErellgreivnvvacegaerrerhe 310
                 + ++es     + +e+L  +k+l P+ ++vveq+++hn++ Fl rfle+l+yysa+fdsle ++pr+s++r+k+Er  +++ei+nvva eg++r+erhe
  KHM98847.1 279 KYVKESRG---YLKEILLSIKKLGPTALTVVEQDTNHNGHFFLGRFLESLHYYSAIFDSLEPSMPRNSQHRMKIERLHFAEEIRNVVAYEGQDRIERHE 374
                 44433333...5569************************************************************************************ PP

        GRAS 311 tlekWrerleeaGFkpvplsekaakqaklllrkvksdgyrveeesgslvlgWkdrpLvsvSa 372
                 ++ +Wr++l++aGF+ +pl+   ++q++++l+ ++ dgy++ +e+g l+lgWk+rp++++Sa
  KHM98847.1 375 RVDQWRRQLGRAGFQVMPLK--CNSQVRMMLSVYDCDGYTLSSEKGNLLLGWKGRPVIMASA 434
                 *******************7..569************************************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5098510.84783262IPR005202Transcription factor GRAS
PfamPF035146.7E-24156270IPR005202Transcription factor GRAS
PfamPF035147.2E-48279434IPR005202Transcription factor GRAS
PROSITE profilePS5098517.254292418IPR005202Transcription factor GRAS
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
Sequence ? help Back to Top
Protein Sequence    Length: 484 aa     Download sequence    Send to blast
MEDINRWLSF YVNGSVNHDF AIRKYCPARM EQEQGGEWQD QEAAVVFYDT ELCSSSDATG  60
GSTPCLVSSE VDDFVDGFVN MNSDDAYSMV NGGVFEYVPT TLEDSELEIH EALTTTMWEE  120
ETWPVLKLWD VETTNKQSCC LEEFGLWQVL QETRCFAKGL KCRLSLLPHN VIANGTLTSI  180
SMDVPLISRE NKMEAFQLLY QTTPYISFGF MGANEVIYQA SQGKSSMHIV DLGMENTLQW  240
SSLIRALASR PEGHPTLRIT GLTGNEDNSN LQTSMNLNKY VKESRGYLKE ILLSIKKLGP  300
TALTVVEQDT NHNGHFFLGR FLESLHYYSA IFDSLEPSMP RNSQHRMKIE RLHFAEEIRN  360
VVAYEGQDRI ERHERVDQWR RQLGRAGFQV MPLKCNSQVR MMLSVYDCDG YTLSSEKGNL  420
LLGWKGRPVI MASACQKKQG PESSCTFAYS LIEDTKFSKY ESNLRPQREK DITSFQKPGT  480
CQEI
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5hyz_A2e-3115643447373GRAS family transcription factor containing p
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAP0150391e-154AP015039.1 Vigna angularis var. angularis DNA, chromosome 6, almost complete sequence, cultivar: Shumari.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_003545708.10.0PREDICTED: DELLA protein RGL1-like
TrEMBLA0A0B2NUE60.0A0A0B2NUE6_GLYSO; DELLA protein GAIP
STRINGGLYMA08G25800.20.0(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF132512730
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G03450.16e-50RGA-like 2
Publications ? help Back to Top
  1. Qi X, et al.
    Identification of a novel salt tolerance gene in wild soybean by whole-genome sequencing.
    Nat Commun, 2014. 5: p. 4340
    [PMID:25004933]