PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Gorai.013G258300.1
Common NameB456_013G258300, LOC105783290
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Malvales; Malvaceae; Malvoideae; Gossypium
Family bZIP
Protein Properties Length: 365aa    MW: 40573.7 Da    PI: 8.7745
Description bZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Gorai.013G258300.1genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1bZIP_133.77.9e-11281328552
                         CHHHCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS
              bZIP_1   5 krerrkqkNReAArrsRqRKkaeieeLeekvkeLeaeNkaLkkeleel 52 
                         +r+rr++kNRe+A rsR+R++a++ eLe +  +L+ eN +Lk+ +ee 
  Gorai.013G258300.1 281 RRQRRMIKNRESAARSRARRQAYTVELELELNQLKRENAKLKQLVEEN 328
                         69************************************9888655443 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM003383.8E-9277345IPR004827Basic-leucine zipper domain
PROSITE profilePS5021710.841279327IPR004827Basic-leucine zipper domain
PfamPF001701.0E-9281332IPR004827Basic-leucine zipper domain
Gene3DG3DSA:1.20.5.1701.1E-10281330No hitNo description
SuperFamilySSF579593.06E-9281327No hitNo description
PROSITE patternPS000360284299IPR004827Basic-leucine zipper domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 365 aa     Download sequence    Send to blast
MALSESESVA YGGIKKTGSP TQAPESPHEE STPDRSNSSP NKQNSIFSLT LDEIQLKSGK  60
TFGSMNMDEF LANLWNVEEN QQVISQPEPI DGDRGIGCQP SLARQGSFSV PTPLCKKTVD  120
EVWFEIQKEL PQPREANDVA DHEPPQRQQT LGEITLEDFL IKAGVVQEPS GSSQQNKASP  180
LRINGASLDA NYIMDAPIRN NNASMDANFG MGHMIGLGFP RHQIVSNGYA AGYSIFAQTV  240
MGESSNGTEN GNRTNSLLQP AVAPQNKKRI VDGPPEVVVE RRQRRMIKNR ESAARSRARR  300
QAYTVELELE LNQLKRENAK LKQLVEENDK RRKEEVLKRK KELTCAKKKV DKMMTLRRTV  360
SLGW*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_012464119.10.0PREDICTED: ABSCISIC ACID-INSENSITIVE 5-like protein 1
SwissprotQ8RYD62e-84AI5L1_ARATH; ABSCISIC ACID-INSENSITIVE 5-like protein 1
TrEMBLA0A0D2U7840.0A0A0D2U784_G
STRINGPOPTR_0009s16610.11e-116(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM116522230
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G44460.17e-70bZIP family protein
Publications ? help Back to Top
  1. Paterson AH, et al.
    Repeated polyploidization of Gossypium genomes and the evolution of spinnable cotton fibres.
    Nature, 2012. 492(7429): p. 423-7
    [PMID:23257886]